Neuropeptides

Product Name Calcitonin, eel TFA Biological activity Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis. Formula Formula C148H242F3N43O49S2 Appearance Solid Color White to off-white Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7) Storage…

Product Name Cortistatin-29 (rat) Biological activity Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects. Molecular Weight 3540.04 Formula Formula…

Product Name GIP, human TFA Biological activity GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Formula Formula C226H338N60O66S.xC2HF3O2 Appearance…

Product Name β-Melanocyte Stimulating Hormone (MSH), human Biological activity β-Melanocyte Stimulating Hormone (MSH), human, a 22-residue peptide, acts as an endogenous melanocortin-4 receptor (MC4-R) agonist. Molecular Weight 2660.92 Formula Formula C118H174N34O35S CAS Number 17908-57-5 Appearance Solid Color White to off-white Sequence Sequence Ala-Glu-Lys-Lys-Asp-Glu-Gly-Pro-Tyr-Arg-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp Sequence Shortening Sequence Shortening AEKKDEGPYRMEHFRWGSPPKD

Product Name Xenin-8 TFA Biological activity Xenin-8 TFA is the C-terminal octapeptide fragment of xenin, which belongs to the xenopsin family of peptides. Xenin-8 TFA stimulates basal insulin secretion, dose-dependently enhances glucose (EC50 = 0.16 nM) and arginine-induced insulin release, and enhances arginine- and Carbamoylcholine chloride (HY-B1208)-induced glucagon secretion. Xenin-8 TFA antagonizes the inhibition of…

Product Name N,N-Diallyl-Tyr-Aib-Aib-Phe-Leu Biological activity N,N-Diallyl-Tyr-Aib-Aib-Phe-Leu is a compound that can antagonize the δ-opioid receptor and the action of enkephalin in vivo. Its antagonistic effect can be verified by specific behavioral experiments. Formula Formula C38H53N5O7 CAS Number 92535-15-4 Sequence Sequence {N,N-Diallyl}-Tyr-{Aib}-{Aib}-Phe-Leu Sequence Shortening Sequence Shortening {N,N-Diallyl}-Y-{Aib}-{Aib}-F-Leu Storage Please store the product under the recommended conditions…

Product Name Cholecystokinin Octapeptide (1-2) desulfated Biological activity Cholecystokinin Octapeptide (1-2) (desulfated) (H-Asp-Tyr-OH) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research…

Product Name Amylin (IAPP), feline TFA Biological activity Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion. Formula Formula C165H272N52O54S2.xC2HF3O2 Appearance Solid…