Insert HTML here
Showing 609–624 of 883 results
Product Name Hepcidin-1 (mouse) TFA Biological activity Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA…
Product Name β-Casomorphin (1-5), bovine TFA Biological activity β-Casomorphin (1-5), bovine (TFA) is a peptide of bovine β-Casomorphin. CAS Number 2828433-20-9 Sequence Sequence Tyr-Pro-Phe-Pro-Gly Sequence Shortening Sequence Shortening YPFPG Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name MPQPPAK Biological activity MPQPPAK is a polypeptide obtained from the enzymatic hydrolysis of C-phycocyanin (HY-D1025) and possesses neuroprotective activity. MPQPPAK enhances the activities of antioxidant enzymes SOD, CAT, and GSH-Px, reduces ROS, inhibits apoptosis and acetylcholinesterase (AChE) activity in brain tissue, and decreases protein carbonyl content. In the MPTP (HY-W114750)-induced zebrafish Parkinson’s disease…
Product Name (D-Ser1)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) Biological activity (D-Ser1)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is an adrenocorticotropic hormone (ACTH) analogue. Formula Formula C136H210N40O31S CAS Number 18067-65-7 Appearance Solid Color White to off-white Sequence Sequence {d-Ser}-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening {d-Ser}-YSMEHFRWGKPVGKKRRPVKVYP Storage Sealed storage, away from moisture Powder…
Product Name Obestatin(human) TFA Biological activity Obestatin(human) TFA is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats. Sequence Shortening Sequence Shortening FNAPFDVGIKLSGVQYQQHSQAL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name N-Acetyloxytocin Biological activity N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat. Formula Formula C45H68N12O13S2 CAS Number 10551-48-1 Appearance Solid Color White to off-white Sequence Sequence Ac-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening Ac-CYIQNCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed…
Product Name Neuropeptide S (Mouse) TFA Biological activity Neuropeptide S(Mouse) TFA is a potent endogenous neuropeptide S receptor (NPSR) agonist (EC50=3 nM). Neuropeptide S(Mouse) TFA induces mobilization of intracellular Ca2+. Neuropeptide S(Mouse) TFA increases locomotor activity and wakefulness in mice. Neuropeptide S(Mouse) TFA also reduces anxiety-like behavior in mice. Sequence Sequence Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Ala-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln (TFA) Sequence Shortening…
Product Name Pancreatic polypeptide TFA Biological activity Pancreatic polypeptide TFA is a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed…
Product Name FW 34-569 Biological activity FW 34-569 is an active compound. CAS Number 70021-31-7 Sequence Sequence Me-Tyr-{d-Ala}-Gly-{Phe(Me)}-{Met(O)-ol} Sequence Shortening Sequence Shortening Me-Y-{d-Ala}-G-{Phe(Me)}-{Met(O)-ol} Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide SF(mouse,rat) TFA Biological activity Neuropeptide SF (mouse,rat) TFA is a potent neuropeptide FF receptor agonist with Ki values are 48.4 nM and 12.1 nM for NPFF1 and NPFF2, respectively. Neuropeptide SF TFA increases the amplitude of the sustained current of heterologously expressed acid sensing ion channel 3 (ASIC3) . Formula Formula C42H66F3N13O12…
Product Name Neuromedin S(rat) Biological activity Neuromedin S(rat) is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1 CAS Number 843782-19-4 Sequence Sequence Leu-Pro-Arg-Leu-Leu-His-Thr-Asp-Ser-Arg-Met-Ala-Thr-Ile-Asp-Phe-Pro-Lys-Lys-Asp-Pro-Thr-Thr-Ser-Leu-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening Sequence Shortening LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN-NH2 Storage Please store the product under…
Product Name Adrenomedullin (1-50), rat Biological activity Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor. Molecular Weight 5729.5 Formula Formula C242H381N77O75S5 CAS Number 161383-47-7 Appearance Solid Color White to off-white Sequence Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19) Sequence Shortening Sequence Shortening YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge:…
Product Name Urofollitropin Biological activity Urofollitropin is a protein extract of human menopausal urine. Urofollitropin has the function of promoting follicle development and maturation, but contains very small amounts of urinary proteins. CAS Number 97048-13-0 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide Y (human) free acid Biological activity Neuropeptide Y (human) free acid is the deamidated form of Neuropeptide Y (human, rat, mouse) (HY-P0198). The amidation of Neuropeptide Y C-terminal tyrosine is critical for its function. Non-amidated Neuropeptide Y fails to elicit G protein signaling. CAS Number 99575-89-0 Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr Sequence Shortening Sequence…
Product Name [Nle8,18,Tyr34]-pTH (3-34) amide (bovine) Biological activity -pTH (3-34) amide (bovine) (bPTH (3-34) amide) is an analogue of parathyroid hormone (PTH), and is a competitive inhibitor of PTH-stimulated biological responses in vitro. CAS Number 64297-16-1 Sequence Sequence Ser-Glu-Ile-Gln-Phe-{Nle}-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-{Nle}-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 Sequence Shortening Sequence Shortening SEIQF-{Nle}-HNLGKHLSS-{Nle}-ERVEWLRKKLQDVHNY-NH2 Storage Please store the product under the recommended conditions in the…
Product Name Human follicular gonadotropin releasing peptide Biological activity Human follicular gonadotropin releasing peptide (hF-GRP) is a hormone peptide. Human follicular gonadotropin releasing peptide can stimulate pituitary luteinizing hormone (LH) and follicle-stimulating hormone (FSH) secretion in vitro. Formula Formula C68H94N22O27 CAS Number 107873-08-5 Sequence Shortening Sequence Shortening TDTSHHDQDHPTFN Storage Please store the product under the…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us