Insert HTML here
Showing 33–48 of 883 results
Product Name YMRF-NH2 Biological activity YMRF-NH2 is a neuropeptide. YMRF-NH2 binds to FMRFa-R with an EC50 value of 31 nM. Formula Formula C29H42N8O5S CAS Number 83903-32-6 Sequence Shortening Sequence Shortening YMRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Des-Gly10,D-His2,D-Trp6,Pro-NHEt9)-LHRH Biological activity (Des-Gly10,D-His2,D-Trp6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1872435-01-2 Sequence Sequence…
Product Name (Des-Thr5)-Glucagon Biological activity (Des-Thr5)-Glucagon is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1802078-27-8 Sequence Sequence…
Product Name (Des-Pyr1,Des-Gly10,D-Leu6,Pro-NHEt9)-LHRH Biological activity (Des-Pyr1,Des-Gly10,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1642799-35-6 Sequence Sequence…
Product Name (Des-His6)-ACTH (1-24) (human, bovine, rat) Biological activity (Des-His6)-ACTH (1-24) (human, bovine, rat) is an analogue of Adrenocorticotropic hormone (ACTH; HY-106373). ACTH is a polypeptide tropic hormone produced by the anterior pituitary gland, regulating cortisol and androgen production. CAS Number 1926163-11-2 Sequence Sequence Ser-Tyr-Ser-Met-Glu-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening SYSMEFRWGKPVGKKRRPVKVYP Storage Please store the product…
Product Name (Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt9)-LHRH Biological activity (Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 134009-10-2 Sequence Sequence…
Product Name (Des-Ser3)-ACTH (1-24) (human, bovine, rat) Biological activity (Des-Ser3)-ACTH (1-24) (human, bovine, rat) is a peptide analog of the adrenocorticotropic hormone (ACTH). ACTH stimulates the production of cortisol. CAS Number 1926163-12-3 Sequence Sequence Ser-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening SYMEHFRWGKPVGKKRRPVKVYP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Des-acetyl)-α-MSH Biological activity (Des-acetyl)-α-MSH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 53697-27-1 Sequence Sequence…
Product Name Human Growth Hormone (1-43) Biological activity Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like activity. Human Growth Hormone (1-43) can be used to study the function and metabolic pathways of growth hormone, a potential obesity-related factor. CAS Number 96827-07-5 Appearance Solid Color White to…
Product Name Perisulfakinin Biological activity Perisulfakinin, a satiety signaling neuropeptide, inhibits the activity of central neurons promoting general activity. CAS Number 125131-58-0 Sequence Sequence Glu-Gln-Phe-Asp-Asp-{Tyr(SO3H)}-Gly-His-Met-Arg-Phe-NH2 Sequence Shortening Sequence Shortening EQFDD-{Tyr(SO3H)}-GHMRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (Met(O)27)-Glucagon (1-29) (human, rat, porcine) Biological activity (Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor….
Product Name Hepcidin-1 (mouse) Biological activity Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation. Molecular Weight…
Product Name pTH (1-38) (human) Biological activity pTH (1-38) (human) is a human parathyroid hormone fragment 1-38 and is an anabolic bone agent. pTH (1-38) (human) can be used for the research of osteoporosis. Formula Formula C197H319N59O55S2 CAS Number 78232-94-7 Appearance Solid Color White to off-white Sequence Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly Sequence Shortening Sequence Shortening SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG Storage…
Product Name Angiotensin I/II (1-5) TFA Biological activity Angiotensin I/II 1-5 TFA is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science,…
Product Name (Glu13,17,20)-Osteocalcin (1-46) (mouse) Biological activity (Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism. CAS Number 1802086-27-6 Appearance Solid Color White to off-white Sequence Sequence Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile (Disulfide bridge: Cys19-Cys25) Sequence Shortening Sequence Shortening YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25) Storage Sealed…
Product Name (Glu24)-Glucagon (1-29) (human, rat, porcine) Biological activity (Glu24)-Glucagon (1-29) (human, rat, porcine) is a fragment of glucagon. CAS Number 308356-99-2 Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Glu-Trp-Leu-Met-Asn-Thr Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAQDFVEWLMNT Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us