Insert HTML here
Showing 593–608 of 883 results
Product Name Amylin (8-37), human Biological activity Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological…
Product Name Parathyroid Hormone (1-34), human, biotinylated Biological activity Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns. Appearance Solid Color White to off-white Sequence Sequence…
Product Name Serum thymic factor Biological activity Serum thymic factor (Thymulin) is a zinc-dependent immunoregulatory peptide hormone produced by thymic epithelial cells. Serum thymic factor stimulates the release of hormones from the pituitary gland and exhibits pituitary-promoting activity. Serum thymic factor protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor possesses…
Product Name pTH-Related Protein (1-34) amide (human, mouse, rat) Biological activity pTH-Related Protein (1-34) amide (human, mouse, rat) (Human PTHrP-(1-34)NH2) is a N-terminal fragments of PTHrP. pTH-Related Protein (1-34) amide (human, mouse, rat) induces hypercalcemia, and can be used for research of humoral hypercalcaemia of malignancy. CAS Number 112955-31-4 Appearance Solid Color White to off-white…
Product Name Neurotensin (1-8) Biological activity Neurotensin (1-8) is a polypeptide and an N-terminal metabolite fragment of Neurotensin (NT 1-13) that can be detected as a stable circulating metabolite. Neurotensin (1-8) is useful for research related to neurotensin metabolism and gastrointestinal endocrinology. Formula Formula C46H71N13O14 CAS Number 80887-44-1 Sequence Sequence {Pyr}-Leu-Tyr-Glu-Asn-Lys-Pro-Arg Sequence Shortening Sequence Shortening…
Product Name CRF, bovine Biological activity CRF, bovine is a potent agonist of CRF receptor, and displaces ovine CRF with a Ki of 3.52 nM. Molecular Weight 4697.34 Formula Formula C206H340N60O63S CAS Number 92307-52-3 Sequence Sequence Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 Sequence Shortening Sequence Shortening SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name α-CGRP (human) TFA Biological activity α-CGRP (human) (TFA) is a regulatory neuropeptide of 37 amino acids. α-CGRP (human) (TFA) is widely distributed in the central and peripheral nervous system. α-CGRP (human) (TFA) is a potent vasodilator and has inotropic and chronotropic effects. Formula Formula C163H267N51O49S2??xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence…
Product Name Bradykinin (1-5) Biological activity Bradykinin (1-5) is a metabolite of Bradykinin (HY-P0206) and a PAR inhibitor that inhibits thrombin-induced platelet aggregation by preventing protease-activated receptor (Protease Activated Receptor) cleavage and inhibiting Thrombin (MW 37kDa) (HY-114164). Bradykinin (1-5) is used in research on thrombosis, carrageenan-induced pleurisy, nasal allergy, and hereditary angioedema. Molecular Weight 572.66…
Product Name Nocistatin Biological activity Nocistatin, a neuropeptide, is an endogenous ligand for the orphan opioid receptor-like receptor. Nocistatin is also a functional antagonist of neuropeptide nociceptin or orphanin FQ (Noc/OFQ). Nocistatin inhibits 5-HT release via a Gi/o proteinmediated pathway. Nocistatin blocks Nociceptin (Nociceptin)-induced allodynia and hyperalgesia. Molecular Weight 772.85 Formula Formula C32H56N10O12 CAS Number…
Product Name Bradykinin (1-3) Biological activity Bradykinin (1-3) is a 3-amino acid residue peptide. Bradykinin (1-3) is an amino-truncated Bradykinin peptide, cleaved by Prolyl endopeptidase. CAS Number 23815-91-0 Sequence Sequence Arg-Pro-Pro Sequence Shortening Sequence Shortening RPP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Cyclic somatostatin acetate Biological activity Cyclic somatostatin (SRIF-14) acetate is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin acetate is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin acetate inhibits the…
Product Name [Nle8,18,Tyr34]-pTH (3-34) amide (human) Biological activity -pTH (3-34) amide human (hPTH (3-34) amide) is a parathyroid hormone (PTH) analog. CAS Number 120527-89-1 Sequence Sequence Ser-Glu-Ile-Gln-Leu-{Nle}-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-{Nle}-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 Sequence Shortening Sequence Shortening SEIQL-{Nle}-HNLGKHLNS-{Nle}-ERVEWLRKKLQDVHNY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Type A Allatostatin I Biological activity Type A Allatostatin I is a tridecapeptide. Allatostatins are pleiotropic neuropeptides for inhibition of juvenile hormone synthesis in insects. CAS Number 123209-95-0 Sequence Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2 Sequence Shortening Sequence Shortening APSGAQRLYGFGL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P TFA Biological activity Substance P TFA (Neurokinin P TFA) is a CNS-penetrant neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1461.65 Formula Formula C65H99F3N18O15S CAS Number 148470-19-3 Appearance Solid Color White to off-white…
Product Name Peptide YY (pig) Biological activity Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular…
Product Name Neuropeptide DF2 Biological activity Neuropeptide DF2 is a DRNFLRFamide neuropeptide orignally isolated from crayfish. which enhances transmitter release and stimulates the amplitude of excitatory post-synaptic potentials (EPSP) through the calcium/calmodulin-dependent protein kinase. CAS Number 149471-11-4 Sequence Sequence Asp-Arg-Asn-Phe-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening DRNFLRF-NH2 Storage Please store the product under the recommended conditions in…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us