Insert HTML here
Showing 545–560 of 883 results
Product Name Substance P, Free Acid Biological activity Substance P, Free Acid is a native substance P analog, but shows no biological activity of substance P. CAS Number 71977-09-8 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met Sequence Shortening Sequence Shortening RPKPQQFFGLM Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1…
Product Name Cholecystokinin-J Biological activity Cholecystokinin-J (CCK-J), a cholecystokinin, stimulates Ca2+ release. CAS Number 144396-38-3 Sequence Sequence Boc-Tyr(SO3)-{Nle}-Gly-Tyr-{Nle}-Asp-2-Phenylethyl ester Sequence Shortening Sequence Shortening Boc-{Tyr(SO3)}-{Nle}-GY-{Nle}-D-2-Phenylethyl ester Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Allatotropin Biological activity Allatotropin (Manse-AT) is a 13 amino acid neuropeptide. Allatotropin activates inositol 1,4,5-trisphosphate (IP3) pathway, and the biosynthesis of juvenile hormone (JH) in Manduca sexta. CAS Number 120928-88-3 Sequence Sequence Gly-Phe-Lys-Asn-Val-Glu-Met-Met-Thr-Ala-Arg-Gly-Phe-NH2 Sequence Shortening Sequence Shortening GFKNVEMMTARGF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Dehydro-Pro4] Substance P (4-11) Biological activity Substance P (4-11) is a peptide fragment of Substance P. Substance P is a peptide mainly secreted by neurons. Substance P takes part in many biological processes, including nociception, inflammation and immunity. Sequence Shortening Sequence Shortening Dehydro-PQQFFGLM-NH2 Storage Please store the product under the recommended conditions in…
Product Name Neuropeptide Y (1-24) (human) Biological activity Neuropeptide Y (1-24) (human) is a neuropeptide with potencies in inhibiting the electricity stimulated twitch response of rat vas deferens. Neuropeptide Y (1-24) (human) stimulates N-methyl-D-aspartate (NMDA)-induced neuronal activation in the rat CA3 region of the dorsal hippocampus in vivo. Formula Formula C116H170N30O40S CAS Number 131448-51-6 Sequence…
Product Name LH-RH (4-10) Biological activity LH-RH (4-10) is a heptapeptide, one of major degradation products of luteinising-hormone releasing hormone (LHRH) via pituitary and hypothalamus. LH-RH (4-10) produced in macrophages and type II pneumocytes. Formula Formula C33H53N11O9 CAS Number 51776-33-1 Sequence Shortening Sequence Shortening SYGLRPG-NH2 Storage Please store the product under the recommended conditions in…
Product Name GHRF, bovine Biological activity GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583). Molecular Weight 5104.72 Formula Formula C220H366N72O66S CAS Number 88894-91-1 Sequence Shortening Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Storage Please store the product under the recommended…
Product Name (Glu20)-Glucagon (1-29) (human, rat, porcine) Biological activity (Glu20)-Glucagon (1-29) (human, rat, porcine) is the deamidation product of glucagon. CAS Number 2022956-46-1 Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Glu-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAEDFVQWLMNT Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotin-Gastrin-1, human (1-17) Biological activity Biotin-Gastrin-1, human (1-17) is a biological active peptide. (Biotin-labeled HY-P1097) CAS Number 663625-43-2 Appearance Solid Color White to off-white Sequence Sequence {Biotin-Glu}-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Biotin-Glu}-GPWLEEEEEAYGWMDF-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1…
Product Name PEN (human) Biological activity PEN (human), one of the most abundant hypothalamic neuropeptide and derived from the proprotein ProSAAS, is an endogenous ligand of GPR83. Formula Formula C97H159N27O32 CAS Number 597578-70-6 Appearance Solid Color White to off-white Sequence Sequence Ala-Ala-Asp-His-Asp-Val-Gly-Ser-Glu-Leu-Pro-Pro-Glu-Gly-Val-Leu-Gly-Ala-Leu-Leu-Arg-Val Sequence Shortening Sequence Shortening AADHDVGSELPPEGVLGALLRV Storage Sealed storage, away from moisture and light,…
Product Name Parathyroid Hormone (1-34), bovine TFA Biological activity Parathyroid Hormone (1-34), bovine TFA is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis. Molecular Weight 4222.79 Formula Formula C185H289F3N54O52S2 Sequence Shortening Sequence…
Product Name Cockroach Myoactive Peptide II Biological activity Cockroach Myoactive Peptide II (Pea-CAH-II) is a cockroach neuropeptide. Cockroach Myoactive Peptide II is a member of the adipokinetic hormone/red pigment concentrating hormone (AKH/RPCH) family. Cockroach Myoactive Peptide II can be used for the research of metabolic functions of insect body. Formula Formula C48H65N11O12 CAS Number 93240-39-2…
Product Name Urocortin III (mouse) free acid Biological activity Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Urocortin III (mouse) (free acid) significantly inhibits gastric emptying without modifying colonic transit. Molecular Weight 4171.26 Formula Formula C186H311N51S2 Sequence Shortening Sequence Shortening FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI Storage Please store the…
Product Name CAP2b Biological activity CAP2b is a cardioacceleratory peptide that can be isolated from Drosophila. CAP2b stimulates tubule fluid secretion via cGMP-signaling pathway. CAS Number 170470-44-7 Sequence Sequence {pGlu}-Leu-Tyr-Ala-Phe-Pro-Arg-Val-NH2 Sequence Shortening Sequence Shortening {pGlu}-LYAFPRV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Carassin Biological activity Carassin is a 21 amino acid tachykinin-related peptide, it can be isolated from the goldfish brain. Carassin has moderate affinity for rat tachykinin binding sites. CAS Number 133950-47-7 Sequence Shortening Sequence Shortening SPANAQITRKRHKINSFVGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neurotensin(8-13) Biological activity Neurotensin (8-13) is an active fragment of Neurotensin. Neurotensin(8-13) results in a decrease in cell-surface NT1 receptors (NTR1) density. Molecular Weight 816.99 Formula Formula C38H64N12O8 CAS Number 60482-95-3 Appearance Solid Color White to off-white Sequence Sequence Arg-Arg-Pro-Tyr-Ile-Leu Sequence Shortening Sequence Shortening RRPYIL
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us