Insert HTML here
Showing 1–16 of 883 results
Product Name ??-MSH Biological activity ??-MSH is a melanocortin peptide. ??-MSH is a weak melanocortin receptor (MCRs) ligand. CAS Number 100930-04-9 Sequence Sequence Ser-Met-Glu-Val-Arg-Gly-Trp Sequence Shortening Sequence Shortening SMEVRGW Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Big Endothelin-3 (22-41) amide (human) Biological activity Big Endothelin-3 (22-41) amide (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Product Name Atrial Natriuretic Factor (5-27) (human) Biological activity Atrial Natriuretic Factor (5-27) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Product Name (Des-Glu5)-ACTH (1-24) (human, bovine, rat) Biological activity (Des-Glu5)-ACTH (1-24) (human, bovine, rat) is an analogue of Adrenocorticotropic hormone (ACTH; HY-106373). ACTH is a polypeptide tropic hormone produced by the anterior pituitary gland, regulating cortisol and androgen production. CAS Number 1815617-95-8 Sequence Sequence Ser-Tyr-Ser-Met-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening SYSMHFRWGKPVGKKRRPVKVYP Storage Please store the product…
Product Name (Cys(Acm)6,12)-Orexin A (human, mouse, rat) Biological activity (Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
Product Name (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH Biological activity (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 267878-61-5 Sequence Sequence…
Product Name NGFFFamide Biological activity NGFFFamide is a muscle-active neuropeptide found in sea urchins. NGFFFamide regulates muscle activity by directly interacting with receptor proteins on muscle cells, or indirectly by stimulating nerves or other cell types to release muscle-active factors. NGFFFamide can be used to study muscle contraction and relaxation. CAS Number 1219926-09-6 Sequence Sequence…
Product Name Gastrin I (human) sulfated Biological activity Gastrin I (human) (sulfated) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and…
Product Name Neuromedin U-8 (porcine) Biological activity Neuromedin U-8 (porcine) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. Formula…
Product Name (D-Leu7)-LHRH Biological activity (D-Leu7)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 53728-75-9 Sequence Sequence…
Product Name Proadrenomedullin (1-20) (rat) Biological activity Proadrenomedullin (1-20, rat) (Rat PAMP) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and…
Product Name [Ala2] Endothelin-3, human Biological activity Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it…
Product Name Big Endothelin-2 (1-38), human Biological activity Big Endothelin-2 (1-38), human is a polypeptide. CAS Number 142191-53-5 Sequence Shortening Sequence Shortening CSCSSWLDKECVYFCHLDIIWVNTPEQTAP YGLGNPPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH Biological activity (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH is an analogue of luteinizing hormone-releasing hormone (LHRH). LHRH plays a central role in the control of reproduction by stimulating the release of pituitary luteinizing hormone (LH) and follicle-stimulating hormone (FSH). CAS Number 1926163-38-3 Sequence Sequence {Pyr}-His-Trp-Ser-Tyr-{d-Ser(tBu)}-{d-Leu}-Arg-Pro-{Azagly}-NH2 Sequence Shortening Sequence Shortening {Pyr}-HWSY-{d-Ser(tBu)}-{d-Leu}-RP-{Azagly}-NH2 Storage Please store the product under the…
Product Name (D-Ser4)-LHRH Biological activity (D-Ser4)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 103065-82-3 Sequence Sequence…
Product Name Somatostatin-14 (reduced) Biological activity Somatostatin-14 (reduced) (SST 14) is a polypeptide that can be found by peptide screening. Formula Formula C76H106N18O19S2 CAS Number 40958-31-4 Appearance Solid Color White to off-white Sequence Sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys Sequence Shortening Sequence Shortening AGCKNFFWKTFTSC Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us