Antimicrobial Peptides

Melittin TFA is a PLA2 activator that stimulates the activity of low molecular weight PLA2 without increasing the activity of high molecular weight PLA2. Product Details Product Name Melittin TFA Biological activity Melittin TFA is a PLA2 activator, stimulates the activity of the low molecular weight PLA2, while it does not the increase activity of…

Metalnikowin I (MetI) is a proline-rich antimicrobial peptide and DnaK inhibitor. Metalnikowin I can be extracted from insects. Product Details Product Name Metalnikowin I Biological activity Metalnikowin I (MetI) is a proline-rich antimicrobial peptide and DnaK inhibitor. Metalnikowin I can be derived from insects. Sequence Val-Asp-Lys-Pro-Asp-Tyr-Arg-Pro-Arg-Pro-Arg-Pro-Pro-Asn-Met Sequence Shortening VDKPDYRPRPRPPNM Storage Please store the product under…

Microcystin YR (Cyanoginosin YR) is a cyclic peptide and a protein phosphatase 2A (PP2A) inhibitor. Product Details Product Name Microcystin YR Biological activity Microcystin YR (Cyanoginosin YR), a cyclic peptide, is a protein phosphatase 2A (PP2A) inhibitor. CAS Number 101064-48-6 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Mram 8 is a cyclic peptide isolated from the violet family plant Viola. Product Details Product Name Mram 8 Biological activity Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family. Sequence Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) Sequence Shortening Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) Storage Please store the product under the recommended…

Myxinidin is an antimicrobial peptide. Myxinidin has the ability to inhibit and eradicate biofilms formed by Pseudomonas aeruginosa and various Candida species. Myxinidin can be used in infection research. Product Details Product Name Myxinidin Biological activity Myxinidin is an antimicrobial peptide. Myxinidin exhibits the ability to inhibit and eradicate biofilms formed by Pseudomonas aeruginosa and…

N2W2 is a tryptophan- and lysine-rich ??-hairpin antimicrobial peptide. N2W2 has potent antibacterial activity but also high toxicity. N2W2 is highly sensitive to trypsin or chymotrypsin. N2W2 can be used in research on bacterial infections. Product Details Product Name N2W2 Biological activity N2W2 is a tryptophan- and lysine-rich ??-hairpin antimicrobial peptide. N2W2 exhibits potent antimicrobial…

Nisin is a lantibiotic produced by a group of Gram-positive bacteria belonging to the genera Lactococcus and Streptococcus. Nisin has antibacterial and anti-inflammatory activities. Product Details Product Name Nisin Biological activity Nisin is a bacteriocin produced by a group of Gram-positive bacteria that belongs to Lactococcus and Streptococcus species. Nisin has antibacterial and anti-inflammatory activity….

Nisin Z is an antibacterial and anti-inflammatory peptide. Nisin Z is effective against Gram-positive bacteria and fungi, such as C. albicans. Product Details Product Name Nisin Z Biological activity Nisin Z is an antimicrobial and anti-inflammatory peptide. Nisin Z is effective against Gram-positive bacteria and fungi, such as C. albicans. Formula C141H229N41O38S7 CAS Number 137061-46-2…