Product Name Brain Natriuretic Peptide (1-32), rat Biological activity Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). Molecular Weight 3452.94 Formula Formula C146H239N47O44S3 CAS Number 133448-20-1 Sequence Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)…
Product Name Neuropeptide W-30 (human) Biological activity Neuropeptide W-30 (human) is an important stress mediator in the central nervous system that modulates the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. Neuropeptide W-30 (human) is an endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8. Neuropeptide W-30 (human) activates and binds to…
Product Name Calcitonin, porcine Biological activity Calcitonin, porcine inhibits 1,25 (OH)2D3-stimulated porcine osteoclast differentiation. Calcitonin is a polypeptide hormone that can lower serum calcium by decreasing calcium reabsorption in the kidney and inhibiting osteoclastic bone resorption. Calcitonin, porcine can be used for research of hypercalcemia. CAS Number 12321-44-7 Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH2 (Disulfidebridge:Cys1-Cys7) Sequence Shortening Sequence…
Product Name Prosomatostatin (1-32), porcine Biological activity Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide. Formula Formula C161H260N44O45 CAS Number 99694-34-5 Sequence Shortening Sequence Shortening APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Cyclic SSTR agonist octreotide Biological activity Cyclic SSTR agonist octreotide is a Octreotide (HY-P0036), serving as the cyclic Somatostatin Receptor SSTR agonist. Sequence Sequence Phe-Cys-Phe-Asp-Trp-Lys-Thr-Cys-Thr Sequence Shortening Sequence Shortening FCFDWKTCT Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Canine KP-10 Biological activity Canine KP-10 is a potent kisspeptin that elicits strong gonadotropin and estradiol responses in female dogs in estrus. Sequence Sequence Tyr-Asn-Trp-Asn-Val-Phe-Gly-Leu-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YNWNVFGLRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name YNPCVMYL (Thioester: Cys4-Leu8) Biological activity YNPCVMYL (Thioester: Cys4-Leu8) is a polypeptide chain of the YNPCVMYL sequence. The link between the fourth and eighth amino acids in the sequence has the properties of a thioester, which is formed between cysteine (Cys4) and leucine (Leu8). Sequence Sequence Tyr-Asn-Pro-Cys-Val-Met-Tyr-Leu (Thioester: Cys4-Leu8) Sequence Shortening Sequence Shortening YNPCVMYL…
Product Name CART(55-102)(rat) Biological activity CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior. CAS Number 209615-79-2 Appearance Solid Color White to off-white Sequence Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Sealed storage,…
Product Name Adrenotensin (human) Biological activity Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones. Formula Formula C143H224N42O43 CAS Number 166546-72-1 Sequence Sequence Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu Sequence Shortening Sequence Shortening SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL Storage Please store the…
Product Name [Leu13]-Motilin Biological activity -Motilin (KW-5139) is a motilin analogue. -Motilin stimulates gastrointestinal motility in the rabbit. -Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro. CAS Number 59530-69-7 Sequence Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln Sequence Shortening Sequence Shortening FVPIFTYGELQRLQEKERNKGQ Storage Please store the product under the recommended conditions…
Product Name Proinsulin C-Peptide (31-63), porcine Biological activity Proinsulin C-Peptide (31-63), porcine is a peptide fragment of the cleavage product porcine proinsulin. CAS Number 28152-90-1 Sequence Shortening Sequence Shortening RREAENPQAGAVELGGGLGGLQALALEGPPQKR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Angiotensin I/II (4-8) Biological activity Angiotensin I/II (4-8), a major metabolite of Angiotensin II, is a C-terminal 4-8 pentapeptide. CAS Number 52530-60-6 Sequence Shortening Sequence Shortening YIHPF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) Biological activity (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is the reaction product with gadolinium tetraazacyclododecanetriacetate derivative. (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) involves in preparation of tetraazacyclododecane macrocycle metal complexes for production of conjugates with biomolecules and for…
Product Name Gastric Inhibitory Polypeptide (1-30), porcine Biological activity Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin. CAS Number 134875-67-5 Sequence Shortening Sequence Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQK Storage Please store the product under the recommended conditions…
Product Name Thymus Factor Biological activity Thymus Factor (Thymulin) is a key factor responsible for the maturation of humoral immunological faculty. Thymulin is an inhibitor of ERK. CAS Number 62036-77-5 Sequence Shortening Sequence Shortening QAKSQGGSN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Amount: 1 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Apelin Purity: >90% (HPLC-MS) Quantification: No Sequence: H-YQRPRLSHKGPMPF-OH Specifications: 14mer cancer peptide
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
![[Nle11]-Substance P](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)
![[Tyr0]-Apelin-13](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides1-300x300.jpg)