Insert HTML here
Showing 161–176 of 3705 results
Product Name Angiotensin I/II (1-6) TFA Biological activity Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for…
Product Name GRPP (human) Biological activity GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets. CAS Number 1132745-52-8 Appearance Solid Color White to off-white Sequence Sequence Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp Sequence Shortening Sequence Shortening RSLQDTEEKSRSFSASQADPLSDPDQMNED…
Product Name Alarin (human) Biological activity Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP. CAS Number 909409-86-5 Sequence Sequence Ala-Pro-Ala-His-Arg-Ser-Ser-Thr-Phe-Pro-Lys-Trp-Val-Thr-Lys-Thr-Glu-Arg-Gly-Arg-Gln-Pro-Leu-Arg-Ser Sequence Shortening Sequence Shortening APAHRSSTFPKWVTKTERGRQPLRS Storage Please store the product…
Product Name ANP (1-30), frog Biological activity ANP (1-30), frog is a peptide fragment of atrial natriuretic peptide derived from frog. ANP (1-30), frog has natriuretic, diuretic, and vasorelaxant effects. CAS Number 309245-16-7 Sequence Shortening Sequence Shortening APRSMRRSSDCFGSRIDRIGAQSGMGCGRF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name β-CGRP, human acetate Biological activity β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells. Molecular Weight 3793.41 (free base) Formula Formula C162H267N51O48S3.xC2H4O2 Sequence Sequence Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide…
Product Name Cholecystokinin Octapeptide, desulfated Biological activity Cholecystokinin Octapeptide, desulfated (CCK Octapeptide, desulfated) is a synthetic desulfated Cholecystokinin octapeptide (HY-P0093). Formula Formula C49H62N10O13S2 CAS Number 25679-24-7 Appearance Solid Color White to off-white Sequence Sequence Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening DYMGWMDF-NH2 Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2 years -20??C…
Product Name Xenopsin TFA Biological activity Xenopsin TFA, a neurotensin-like octapeptide from Xenopus laevis skin. Xenopsin TFA is an inhibitor of Tetragastrin stimulated gastric acid secretion. Formula Formula C49H74F3N13O12 Sequence Sequence {Glp}-Gly-Lys-Arg-Pro-Trp-Ile-Leu Sequence Shortening Sequence Shortening {Glp}-GKRPWIL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Adrenocorticotropic Hormone (ACTH) (18-39), human Biological activity Adrenocorticotropic Hormone (ACTH) (18-39), human is a corticotropinlike intermediate lobe peptide, which is produced in the melanotrophs of the intermediate lobe of the pituitary. Formula Formula C112H165N27O36 CAS Number 53917-42-3 Sequence Sequence Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening RPVKVYPNGAEDESAEAFPLEF Storage Please store the product under the recommended…
Product Name D-JBD19 Biological activity D-JBD19 is an impermeable peptide that serves as an inactive control for the JNK inhibitor D-JNKI1 (HY-P0069). D-JNKI1 has neuroprotective effects. Molecular Weight 2250.56 Formula Formula C99H164N32O28 CAS Number 954134-42-0 Appearance Solid Color White to off-white Sequence Sequence Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg Sequence Shortening Sequence Shortening DQSRPVQPFLNLTTPRKPR
β-CGRP (mouse) (Calcitonin gene-related peptide 2 (mouse)) is a calcitonin gene-related peptide. β-CGRP (mouse) has important physiological functions in the sensory nervous system. β-CGRP may be involved in nociceptive processes. β-CGRP (mouse) plays distinct roles in the neuromuscular system and the gastrointestinal system. Product Information Product Name β-CGRP (mouse) Molecular Weight 3879.29 Formula C165H265N49O55S2 Appearance…
Product Name Glucagon (1-29), bovine, human hydrochloride Biological activity Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation. Molecular Weight 3519.21 Formula Formula C153H226ClN43O49S CAS Number 28270-04-4 Appearance Solid Color White to off-white Sequence…
Product Name Retrobradykinin Biological activity Retrobradykinin has the reverse sequence of Bradykinin (HY-P0206). Retrobradykinin exhibits no kinin activity and can be used as a negative control for Bradykinin. CAS Number 5991-13-9 Sequence Sequence Arg-Phe-Pro-Ser-Phe-Gly-Pro-Pro-Arg Sequence Shortening Sequence Shortening RFPSFGPPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Spexin Biological activity Spexin (Neuropeptide Q) is a selective agonist of galanin receptors GAL2 and GAL3, and is a conserved peptide that functions as a neurotransmitter/neuromodulator and endocrine factor. Spexin can function through both central and peripheral actions. Spexin upregulates Beclin 1 to inhibit ferroptosis induced by excessive autophagy, reduces the uptake of…
Product Name 5-Valine-angiotensin I Biological activity 5-Valine-angiotensin I is an Ang I peptide belonging to angiotensin I. 5-Valine-angiotensin I induces muscle contraction, can be used for renin-angiotensin system studies. Angiotensin I is a putative neurotransmitter, is the precursor of angiotensin II and of angiotensin fragment 1-7, which are involved in regulation of fluid volume and…
β-Corticotropin (swine) is a synthetic form of the peptide hormone corticotropin (ACTH). β-Corticotropin stimulates steroid release. Product Information Product Name β-Corticotropin (swine) CAS Number 12427-33-7
Product Name Neuromedin U-25 (porcine) Biological activity Neuromedin U-25 (porcine) is a uterus stimulating and hypertensive peptides. CAS Number 98395-76-7 Appearance Solid Color White to off-white Sequence Sequence Phe-Lys-Val-Asp-Glu-Glu-Phe-Gln-Gly-Pro-Ile-Val-Ser-Gln-Asn-Arg-Arg-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening Sequence Shortening FKVDEEFQGPIVSQNRRYFLFRPRN-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us