Product Name PEN (rat) Biological activity PEN (rat), one of the most abundant hypothalamic neuropeptide and derived from the proprotein ProSAAS, is an endogenous ligand of GPR83. Formula Formula C102H169N27O33 CAS Number 569364-13-2 Appearance Solid Color White to off-white Sequence Sequence Ala-Val-Asp-Gln-Asp-Leu-Gly-Pro-Glu-Val-Pro-Pro-Glu-Asn-Val-Leu-Gly-Ala-Leu-Leu-Arg-Val Sequence Shortening Sequence Shortening AVDQDLGPEVPPENVLGALLRV Storage Sealed storage, away from moisture Powder -80??C…
Product Name Tyr-Somatostatin-28 Biological activity Tyr-Somatostatin-28 is a somatostatin that adds a Tyrosine amino acid to Somatostatin-28. Formula Formula C146H216N42O41S3 CAS Number 86649-84-5 Sequence Shortening Sequence Shortening YSANSNPAMAPRERKAGCKNFFWKTFTSC (disulfide bridge:Cys18-Cys29) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Sar4] Substance P (4-11) Biological activity Substance P (4-11) is an analog of Substance P (4-11). Substance P (4-11), the C-terminus fragment of Substance P (HY-P0201), is a Substance P agonist. Sequence Shortening Sequence Shortening {Sar}-QQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name β-Bag cell peptide Biological activity β-Bag cell peptide is a neuroactive peptide. β-Bag cell peptide elevates cyclic AMP levels in the bag cell neurons. β-Bag cell peptide decreases the amplitudes of the voltage-dependent potassium currents. Formula Formula C33H53N13O6 CAS Number 109024-47-7 Sequence Shortening Sequence Shortening RLRFH Storage Please store the product under the…
Product Name γ-Neuropeptide (rabbit) Biological activity γ-Neuropeptide (rabbit) can be isolated from rabbit intestine. γ-Neuropeptide is an endogenous neurokinin peptide that acts as a neurokinin 2 (NK2) receptor agonist. γ-Neuropeptide mediates hypothalamic-pituitary-adrenal (HPA) axis, as well as reproductive hormone release. Molecular Weight 2320.59 Formula Formula C99H158N34O29S CAS Number 114882-65-4 Appearance Solid Color White to off-white…
Product Name Biotin-Substance P Biological activity Biotin-Substance P is the biotin tagged Substance P. Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1574.9 Formula Formula C73H112N20O15S2 CAS Number 87468-58-4 Appearance Solid…
Product Name Teriparatide Biological activity Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research. Molecular Weight 4117.72 Formula Formula C181H291N55O51S2 CAS Number 52232-67-4 Appearance Solid Color White to off-white Sequence Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe Sequence Shortening Sequence Shortening SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Product Name α-CGRP (human) Biological activity α-CGRP (human) (Calcitonin gene-related peptide) is a regulatory neuropeptide of 37 amino acids. α-CGRP (human) is widely distributed in the central and peripheral nervous system. α-CGRP (human) is a potent vasodilator and has inotropic and chronotropic effects. Molecular Weight 3789.31 Formula Formula C163H267N51O49S2 CAS Number 90954-53-3 Appearance Solid Color…
Product Name Goserelin acetate Biological activity Goserelin acetate (ICI-118630 acetate), a decapeptide analogue of gonadotropin-releasing hormone (GnRH/LHRH), functions as a GnRH agonist. Goserelin acetate can be used for the research of breast cancer, epithelial ovarian cancer and prostate cancer. Molecular Weight 1269.41 (free base) Formula Formula ??????????? C59H84N18O14??xC2H4O2 CAS Number 145781-92-6 Appearance Solid Color White…
Product Name Ebiratide TFA Biological activity Ebiratide (HOE-427) TFA is an ACTH 4-9 derivative, which acts directly on the central nervous system and exhibits memory-enhancing efficacy. Ebiratide TFA enhances acetycholine (ACh) metabolism in rat brain. Formula Formula C48H73N11O10S.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence {Met(O2)}-Glu-His-Phe-{d-Lys}-{Phe-NH(CH2)8NH2} Sequence Shortening Sequence Shortening {Met(O2)}-EHF-{d-Lys}-{Phe-NH(CH2)8NH2} Storage Sealed storage,…
Product Name Thymotrinan Biological activity Thymotrinan (RGH-0205) is a biologically active fragment of the naturally occurring thymus hormone thymopoietin and a immunomodulating peptide. Thymotrinan exerts similar immunomodulatory activities to TP5 and to affect humoral as well as cellular responses. Formula Formula C16H31N7O6 CAS Number 85465-82-3 Storage Please store the product under the recommended conditions in…
Product Name pTH (1-34) amide (human) Biological activity PTH (1-34) amide human is a type 1 PTH/PTHrP receptor agonist. PTH (1-34) amide human activates adenylate cyclase and phospholipase C pathways, thereby mediating mineral ion homeostasis and bone metabolism regulation. PTH (1-34) amide human increases serum calcium, decreases serum phosphorus, regulates renal excretion, while inducing the…
α-Myosin (614-643) is a segment of polypeptide of the heavy chain of cardiac α-myosin. α-Myosin has a strong ability to induce autoimmune myocarditis. Product Information Product Name α-Myosin (614-643) Molecular Weight 3047.44 Formula C132H220N36O44S CAS Number 176373-77-6 Sequence Ac-Ser-Leu-Lys-Leu-Met-Ala-Thr-Leu-Phe-Ser-Thr-Tyr-Ala-Ser-Ala-Asp-Thr-Gly-Asp-Ser-Gly-Lys-Gly-Lys-Gly-Gly-Lys-Lys-Lys-Gly Sequence Shortening Ac-SLKLMATLFSTYASADTGDSGKGKGGKKKG
Product Name Amylin (IAPP), feline Biological activity Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion. Formula Formula C165H272N52O54S2 CAS Number 213779-12-5 Sequence Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2…
Product Name Oxytocin free acid Biological activity Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior. CAS Number 4248-64-0 Sequence…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
![[Tyr11]-Somatostatin](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)
