Insert HTML here
Showing 113–128 of 3705 results
![[Glp5] Substance P (5-11)](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)
Product Name Levitide Biological activity Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus. Formula Formula C66H119N21O19S CAS…
Product Name Kentsin Biological activity Kentsin (Thr-Pro-Arg-Lys), a contraceptive tetrapeptide, is originally extracted from hamster embryos. Kentsin prevents the maturation of Graafian follicles and consequently inhibits ovulation, without binding to opioid receptors. Kentsin has opiate properties on gastrointestinal motility. Molecular Weight 500.59 Formula Formula C21H40N8O6 CAS Number 56767-30-7 Sequence Shortening Sequence Shortening TPRK Storage Please…
Product Name [Leu3]-Oxytocin Biological activity -Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu). CAS Number 874701 Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Leu-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYLQNCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage, away from moisture and light Powder -80??C 2 years…
Product Name (Des-Pyr1)-LHRH Biological activity (Des-Pyr1)-LHRH is a Polypeptide Internal Standard, identical to (Des-Pyr1)-GnRH, which can be identified through peptide screening. Peptide screening is a research tool that mainly collects active polypeptides via immunoassays. It can be applied to protein interaction, functional analysis, epitope screening, especially in the field of active molecule research and development….
Product Name [MePhe8,Sar9] Substance P Biological activity Substance P ( Substance P) is an analog of Substance P (HY-P0201). Substance P is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. CAS Number 77128-76-8 Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe(Nme)-{Sar}-Leu-Met–NH2 Sequence Shortening Sequence Shortening RPKPQQF-Phe(Nme)-{Sar}-LM-NH2 Storage Please store the product under the recommended conditions…
Product Name PHI-27 (rat) Biological activity PHI-27 (rat) is a 27 amino acid peptide.PHI-27 (rat) is used to find peptide hormones and other active peptides. CAS Number 96849-38-6 Sequence Sequence His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 Sequence Shortening Sequence Shortening HADGVFTSDYSRLLGQISAKKYLESLI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide AF (cattle) Biological activity Neuropeptide AF (cattle), an amidated octadecapeptide, is RFamide neuropeptide. Neuropeptide AF (cattle) acts as a ligand of Mas-related gene receptor A4 (MrgprA4) (Mas-related G-protein-coupled Receptor (MRGPR)) (EC50 of ~60 nM) and MrgprC11 (EC50 of ~300 nM). Neuropeptide AF (cattle) also activate to the G protein-coupled receptors NPFF1 (Neuropeptide…
Product Name GRP (porcine) Biological activity GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in…
Product Name Lysipressin acetate Biological activity Lysipressin acetate (Lysine vasopressin acetate; -Vasopressin acetate) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin acetate is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine…
Product Name (D-Phe7)-α-MSH Biological activity (D-Phe7)-α-MSH is an α-MSH analogue. Formula Formula C77H109N21O19S CAS Number 92937-43-4 Sequence Shortening Sequence Shortening Ac-SYSMEH-{d-Phe}-RWGKPV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Trp32)-Neuropeptide Y (porcine) Biological activity (D-Trp32)-Neuropeptide Y (porcine) is a highly selective neuropeptide Y (NPY) Y5 receptor agonist. (D-Trp32)-Neuropeptide Y (porcine) has orexigenic activity and inhibits Forskolin (HY-15371)-stimulated cAMP formation. Formula Formula C197H290N56O56 CAS Number 153549-78-1 Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-{d-Trp}-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDLARYYSALRHYINLI-{d-Trp}-RQRY-NH2 Storage Please store the product under the recommended conditions…
Product Name [D-Leu6, Val7]-LH-RH (1-9) Ethyl Amide Biological activity -LH-RH (1-9) Ethyl Amide is a LHRH peptide analogue. Sequence Shortening Sequence Shortening {Glp}-HWSY-{d-Leu}-VRP-NHEt Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Pmp1,DTyr(OEt)2,Val4,Cit8] Vasopressin Biological activity Vasopressin is an analogue of Vasopressin. CAS Number 1426174-49-3 Sequence Shortening Sequence Shortening Pmp-y(OEt)-FVNCP-Cit-G-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Amylin (8-37) (human) Biological activity Amylin (8-37) (human) (hIAPP (8-37)) is a 8-37 fragment of human islet amyloid polypeptide (IAPP). The duplex folding structure in the Amylin (8-37) (human) assembly has a hairpin structure. Formula Formula C138H215N41O46 CAS Number 309244-90-4 Sequence Shortening Sequence Shortening ATQRLANFLVHSSNNFGAILSSTNVGSNTY Storage Please store the product under the recommended…
Product Name Neuropeptide Y (3-36) (porcine) Biological activity Neuropeptide Y (3-36) (porcine) is an agonist of neuropeptide Y (NPY) receptor subtype Y2, and stimulates feeding in rats. Neuropeptide Y (3-36) (porcine) is a highly Y2 selective ligand compared with nselective Y1/Y2 receptor ligand, Neuropeptide Y 1-36. Molecular Weight 3993.36 Formula Formula C176H271N53O54 CAS Number 143863-88-1…
Product Name BNP (22-46), Pro (Human) Biological activity BNP (22-46), Pro (Human) is an peptide . BNP (22-46), Pro (Human) can be used for the research of cardiac dysfunction. Sequence Shortening Sequence Shortening NHLQGKLSELQVEQTSLEPLQESPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us