Heliomicin is an antimicrobial peptide derived from Heliothis virescens. Product Details Product Name Heliomicin Biological activity Heliomicin is an antimicrobial peptide from Heliothis Virescens. Sequence Asp-Lys-Leu-Ile-Gly-Ser-Cys-Val-Trp-Gly-Ala-Val-Asn-Tyr-Thr-Ser-Asp-Cys-Asn-Gly-Glu-Cys-Lys-Arg-Arg-Gly-Tyr-Lys-Gly-Gly-His-Cys-Gly-Ser-Phe-Ala-Asn-Val-Asn-Cys-Trp-Cys-Glu-Thr (disulfide bridge:Cys7-Cys32,Cys18-Cys40,Cys22-Cys42) Sequence Shortening DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET (disulfide bridge:Cys7-Cys32,Cys18-Cys40,Cys22-Cys42) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-His(Bzl)6)-LHRH (1-7) free acid Biological activity (D-His(Bzl)6)-LHRH (1-7) free acid is a synthetic peptide compound that is a derivative of luteinizing hormone-releasing hormone (LHRH). (D-His(Bzl)6)-LHRH (1-7) free acid enhances its stability and biological activity by introducing unnatural amino acid residues at specific positions of the LHRH molecule. This modification can improve the drug’s…
Product Name Big Endothelin-1 (22-38), human Biological activity Big Endothelin-1 (22-38), human is derived from human, is the 22-38 fragment of Big Endothelin-1 (ET-1) (1-38). Big ET-1 (1-38) is a propeptide of ET-1, which has potent and long-lasting vasoconstrictor effects, equips a specific enzymatic cleavage of the 38 amino acid chain to form ET-1 (1-21)…
Product Name Helospectin I Biological activity Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum. Molecular Weight 4095.63 Formula Formula C183H293N47O59 CAS Number 93438-37-0 Sequence Shortening…
HEP-1 (Human ezrin peptide (324-337)) is an orally effective polypeptide with antiviral, anti-inflammatory, and immunomodulatory activities. HEP-1 is effective against infections caused by a variety of viruses, including HIV, HCV, herpes viruses, HPV, and influenza virus. As an immunomodulator, HEP-1 enhances B cell- and T cell-mediated adaptive immunity. HEP-1 also enhances antibody titers following hepatitis…
Product Name (Des-Gly10,D-Ala6,Pro-NHEt9)-LHRH (salmon) Biological activity (Des-Gly10,D-Ala6,Pro-NHEt9)-LHRH (salmon) is a GnRH analog that induces ovulation and/or spawning in farmed fish. CAS Number 88848-87-7 Appearance Solid Color White to off-white Sequence Sequence {Pyr}-His-Trp-Ser-Tyr-{d-Ala}-Trp-Leu-Pro-{NHEt} Sequence Shortening Sequence Shortening {Pyr}-HWSY-{d-Ala}-WLP-{NHEt} Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6…
Product Name Neuromedin B Biological activity Neuromedin B (NMB) is a member of Bombesin (BN)-like peptide family in mammals. Molecular Weight 1132.29 Formula Formula C52H73N15O12S CAS Number 87096-84-2 Appearance Solid Color White to off-white Sequence Sequence Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2
Product Name (Asp28)-Glucagon (1-29) (human, rat, porcine) Biological activity (Asp28)-Glucagon (1-29) (human, rat, porcine) is a glucagon analog and a GCGR agonist, with the Asn at position 28 replaced by Asp. (Asp28)-Glucagon (1-29) (human, rat, porcine) activates GCGR-mediated cAMP signaling, with EC50 values of 0.067 nM and 0.09 nM, respectively, and an EC50 of 7.99…
Hepcidin-25 (human) is an iron metabolism regulator and antimicrobial agent. Hepcidin-25 (human) exhibits anti-inflammatory and antibacterial activities by regulating iron-mediated oxidative damage. Product Details Product Name Hepcidin-25 (human) Biological activity Hepcidin-25 (human) is an iron metabolism regulator and Antimicrobial agent. Hepcidin-25 (human) exerts anti-inflammatory and antimicrobial activities by regulating iron-mediated oxidative damage. CAS Number 1356390-47-0…
Hepcidin-25 (human) is an iron metabolism regulator and Antimicrobial agent. Hepcidin-25 (human) exerts anti-inflammatory and antimicrobial activities by regulating iron-mediated oxidative damage. Product Information Product Name Hepcidin-25 (human) Molecular Weight 2789.35 Formula C113H170N34O31S9 CAS Number 1356390-47-0 Sequence Asp-Thr-His-Phe-Pro-Ile-Cys-Ile-Phe-Cys-Cys-Gly-Cys-Cys-His-Arg-Ser-Lys-Cys-Gly-Met-Cys-Cys-Lys-Thr (Disulfide bridge:Cys7-Cys23; Cys10-Cys13; Cys11-Cys19; Cys14-Cys22) Sequence Shortening DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridge:Cys7-Cys23; Cys10-Cys13; Cys11-Cys19; Cys14-Cys22)
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ILHNGAYSL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer, Ovarian cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-IISAVVGIL-OH Specifications: 9mer peptide as TFA salt
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
