OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • (Trp6)-LHRH

    (Trp6)-LHRH

    Product Name (Tyr1)-pTH (1-34) (human) Biological activity (Tyr1)-pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…

    Read moreDone
  • (Tyr0)-C-Peptide (dog)

    (Tyr0)-C-Peptide (dog)

    Product Name (Tyr0)-C-Peptide (human) Biological activity (Tyr0)-C-Peptide (human) is a peptide. CAS Number 57327-90-9 Sequence Shortening Sequence Shortening YEAEDLQVGQVELGGGPGAGSLQPLALEGSLQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • (Tyr0)-C-Peptide (human)

    (Tyr0)-C-Peptide (human)

    Product Name Cholecystokinin-33 (swine) Biological activity Cholecystokinin-33 (swine) is a cholecystokinin (CCK) fragment. Cholecystokinin-33 (swine) can reduce food intake and gallbladder contraction. Formula Formula C166H262N50O52S4 CAS Number 67256-27-3 Sequence Sequence Lys-Ala-Pro-Ser-Gly-Arg-Val-Ser-Met-Ile-Lys-Asn-Leu-Gln-Ser-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-{Tyr-SO3H}-Met-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening KAPSGRVSMIKNLQSLDPSHRISDRD-{Tyr-SO3H}-MGWMDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • (Tyr1)-pTH (1-34) (human)

    (Tyr1)-pTH (1-34) (human)

    Product Name (Tyr27)-α-CGRP (27-37) (canine, mouse, rat) Biological activity (Tyr27)-α-CGRP (27-37) (canine, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…

    Read moreDone
  • (Tyr27)-α-CGRP (27-37) (canine, mouse, rat)

    (Tyr27)-α-CGRP (27-37) (canine, mouse, rat)

    Product Name (β-Asp28)-Exenatide Biological activity (β-Asp28)-Exenatide is a potential degradation product of exenatide produced by the formation and cleavage of asparagine. CAS Number 2022972-68-3 Sequence Sequence His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-{β-Asp}-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Sequence Shortening Sequence Shortening HGEGTFTSDLSKQMEEEAVRLFIEWLK-{β-Asp}-GGPSSGAPPPS-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • (TYR34)-PTH (7-34) AMIDE (BOVINE)

    (TYR34)-PTH (7-34) AMIDE (BOVINE)

    Product Name Angiotensinogen (1-14) porcine Biological activity Angiotensinogen (1-14) porcine is a polypeptide, which is the N-terminal fragment of angiotensinogen, including amino acid residues 1 to 14. CAS Number 20845-02-7 Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser Sequence Shortening Sequence Shortening DRVYIHPFHLLVYS Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92)

    [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92)

    [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) is a selective inhibitor of HIV-1. [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) mainly inhibits viral infection and cell fusion by blocking the interaction between HIV-1 and the CD4 molecule. It can completely inhibit fusion formation at a concentration of 25 ??M. Product Details Product Name [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92) Biological activity CD4 (81-92) is a selective inhibitor of HIV-1….

    Read moreDone
  • [1,6-Aminosuberic acid]-arginine-Vasotocin

    [1,6-Aminosuberic acid]-arginine-Vasotocin

    Product Name [Deglycinamide9, Arginine8]-Vasopressin Biological activity -Vasopressin is a Vasopressin (HY-B1811) analog. -Vasopressin induces platelet aggregation. -Vasopressin has hemostatic effect. CAS Number 37552-33-3 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • [5FAM]-RKOpep

    [5FAM]-RKOpep

    Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Substance P Purity: >90% (HPLC-MS) Quantification: No Sequence: 5-FAM-RPKPQQFFGLM-NH2 Specifications: 11mer FAM-labeled cancer peptide

    Read moreDone
  • [8-L-arginine] deaminovasopressin

    [8-L-arginine] deaminovasopressin

    Product Name Intermedin (rat) Biological activity Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1816940-00-7…

    Read moreDone
  • [Ala18] Endothelin-1, human

    [Ala18] Endothelin-1, human

    Product Name Valosin (porcine) Biological activity Valosin (porcine) is a biologically active peptide with 25-amino-acid. Valosin (porcine) can be isolated recently from pig intestine. Valosin (porcine) can be used for the research of digestive system. CAS Number 99510-37-9 Sequence Shortening Sequence Shortening VQYPVEHPDKFLKFGMTPSKGVLFY Storage Please store the product under the recommended conditions in the Certificate…

    Read moreDone
  • [Ala2,8,9,11,19,22,24,25,27,28]-VIP

    [Ala2,8,9,11,19,22,24,25,27,28]-VIP

    Product Name Antho-rwamide I Biological activity Antho-rwamide I is a neuropeptide that can be isolated from the sea anemone Anthopleura elegantissima. Antho-rwamide I is resistant to nonspecific aminopeptidases, which increases the stability of the peptide after neuronal release. CAS Number 114056-25-6 Sequence Sequence {pGlu}-Ser-Leu-Arg-Trp-NH2 Sequence Shortening Sequence Shortening {pGlu}-SLRW-NH2 Storage Please store the product under…

    Read moreDone
  • [Ala2] Endothelin-3, human

    [Ala2] Endothelin-3, human

    Product Name [Tyr0] Gastric Inhibitory Peptide (23-42), human Biological activity Gastric Inhibitory Peptide (23-42), human, a glucose-dependent insulinotropic polypeptide (GIP), is a weak inhibitor of gastric acid secretion that also stimulates insulin secretion. Gastric Inhibitory Peptide (23-42), human can be used in diabetes, obesity research. Formula Formula C119H182N34O31 CAS Number 121765-67-1 Sequence Shortening Sequence Shortening…

    Read moreDone
  • [Ala2] Met-Enkephalinamide

    [Ala2] Met-Enkephalinamide

    Product Name Biotin-Gastrin Releasing Peptide, human Biological activity Biotin-Gastrin Releasing Peptide, human is a biotinylated gastrin releasing peptide (GRP). Gastrin-releasing peptide (GRP) is a neuropeptide with growth-stimulatory and tumorigenic properties. Sequence Sequence Biotin-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence Shortening Sequence Shortening Biotin-VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • [Ala3,11,18, Nle7] Endothelin-1, human

    [Ala3,11,18, Nle7] Endothelin-1, human

    Product Name Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide Biological activity Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin. Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone
  • [Ala6]-LHRH

    [Ala6]-LHRH

    Product Name IRI-514 Biological activity IRI-514 is a synthetic peptide analogue of Thymopentin (HY-N7122). IRI-514 plays a role in modulating behavioral and neuroendocrine responses to stress. CAS Number 147489-65-4 Sequence Sequence Ac-Arg-Pro-Asp-Phe-NH2 Sequence Shortening Sequence Shortening Ac-RPDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone