Product Name Pheromonotropin (pseudaletia separata) Biological activity Pheromonotropin (Pseudaletia separata) (Pss-PT) is an armyworm (Pseudaletia separata) pheromone with the C-terminal pentapeptide FXPRL-amide. Pheromonotropin (Pseudaletia separata) belongs to the PK/PBAN family and stimulates sex pheromone biosynthesis in moths, mediating feeding (intestinal muscle contraction), development (embryonic diapause, pupal diapause, and pupation), and defense against natural enemy insects…
β-Interleukin I (163-171), human, an immunostimulatory fragment of human IL-1β peptide, is a T cell activator. β-Interleukin I (163-171), human is not an IL-1R-binding domain of IL-1β. β-Interleukin I (163-171), human is a potent adjuvant that enhances the immune response in a variety of exptl. situations. Product Information Product Name β-Interleukin I (163-171), human Molecular…
Product Name [Sar1, Ile8]-Angiotensin II TFA Biological activity -Angiotensin II (TFA) is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels. Formula Formula C48H74F3N13O12 CAS Number 2918768-31-5 Appearance Solid Color White to off-white Sequence Sequence {SAR}-Arg-Val-Tyr-Ile-His-Pro-Ile Sequence Shortening Sequence…
Product Name Gastrin I (1-14), human TFA Biological activity Gastrin I (1-14), human TFA is 1-14 fragment of human gastrin I peptide. Gastrin I is an endogenous, gastrointestinal peptide hormone. Gastrin is the major hormonal regulator of gastric acid secretion. Appearance Solid Color White to off-white Sequence Sequence {Glp}-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp Sequence Shortening Sequence Shortening {Glp}-GPWLEEEEEAYGW Storage…
Product Name Big Endothelin-2 (human) Biological activity Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Neuropeptide AF1 Biological activity Neuropeptide AF1 is a FMRFamide-like neuropeptide. Neuropeptide AF1 can be isolated from head extracts of the nematode Ascaris suum. Neuropeptide AF1 rapidly and reversibly abolishs slow membrane potential oscillations of identified ventral and dorsal inhibitory motoneurons and selectively reduces their input resistances. Neuropeptide AF1 inhibits locomotory movements in intact…
Product Name CART(55-102)(human) Biological activity CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y. CAS Number 214050-22-3 Appearance Solid Color White to off-white Sequence Sequence Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Sealed storage, away from moisture and light, under nitrogen…
Product Name GLP-1 (1-36) amide (human, rat) Biological activity GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells. CAS Number 99658-04-5 Appearance Solid Color White to…
Product Name Calcitonin gene-related peptide free acid Biological activity Calcitonin gene-related peptide (CGRP) free acid is a 37-amino acid neuropeptide, which represents the deamidated form of α-CGRP (human) (HY-P1071). Calcitonin gene-related peptide free acid is produced in the central and peripheral nervous systems of rats, and localizes to specific sensory, integrative and motor neuron systems,…
Product Name Biotin-Neurokinin A Biological activity Biotin-Neurokinin A is a biotinylated Neurokinin A (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues. Appearance Solid Color White to off-white Sequence Sequence {Biotin}-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening Sequence…
Product Name Type A Allatostatin III Biological activity Type A Allatostatin III (allatostatin 3) is a blood-brain barrier permeable and reversible neuropeptide that inhibits hormone synthesis in juvenile female cockroaches. Type A Allatostatin III can be used in pesticide research. CAS Number 123209-96-1 Sequence Sequence Gly-Gly-Ser-Leu-Tyr-Ser-Phe-Gly-Leu-NH2 Sequence Shortening Sequence Shortening GGSLYSFGL-NH2 Storage Please store the…
Product Name IGF-I (24-41) TFA Biological activity IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has…
3-WP is a linear icosapeptide with C-terminal amidation modification. 3-WP acts on lipoteichoic acid (LTA) and disrupts cell wall permeability, induces intracellular reactive oxygen species (ROS) accumulation in a dose-dependent manner, and inhibits respiratory chain dehydrogenase activity and intracellular ATP synthesis, thereby interfering with bacterial energy metabolism and exerting antibacterial effects. Combined use of 3-WP…
Amount: 5 mg Application: Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DYKDDDDKDYKDDDDKDYKDDDDK-OH
4F-P-4F peptide is an apoA-I mimetic peptide with a class A amphipathic α-helical structure that acts on ABCA1 and SR-B. 4F-P-4F peptide induces cholesterol efflux from cholesterol-loaded mouse macrophages and promotes HDL remodeling in plasma. 4F-P-4F peptide can be used in research on asthma and atherosclerosis. Product Information Product Name 4F-P-4F peptide Molecular Weight 4618.20…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
