Insert HTML here
Showing 1009–1024 of 3705 results
ChMAP-28 is an antimicrobial peptide. ChMAP-28 can be extracted from goats (Capra hircus). ChMAP-28 induces necrotic cell death. ChMAP-28 effectively kills a variety of bacteria, including strains tolerant to Polymyxin and Meropenem (HY-13678). ChMAP-28 has anti-tumor activity against acute promyelocytic leukemia, epidermoid carcinoma, melanoma, and mammary adenocarcinoma. Product Details Product Name ChMAP-28 Biological activity ChMAP-28…
Cholecystokinin is a peptide hormone. Cholecystokinin, as a hunger suppressant, inhibits food intake and stimulates the digestion of fat and protein. Cholecystokinin can be used for the research of gastrointestinal system. Product Information Product Name Cholecystokinin Molecular Weight 3945.45 Formula C167H263N51O52S4 CAS Number 9011-97-6 Appearance Solid Color White to off-white Sequence Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Ile-Val-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-{Tyr(SO3H)}-Met-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening KAPSGRMSIVKNLQNLDPSHRISDRD-{Tyr(SO3H)}-MGWMDF-NH2…
Product Name Gastric Inhibitory Peptide, porcine Biological activity Gastric Inhibitory Peptide (GIP (1-42)), porcine is a porcine glucose-dependent insulinotropic polypeptide and inhibitor of pentagastrin-stimulated gastric acid secretion. Gastric Inhibitory Peptide, porcine stimulates endogenous somatostatin release. Gastric Inhibitory Peptide, porcine acts in a dose- and time-dependent manner in conscious, chronic gastric fistula-equipped rats. Formula Formula C225H342N60O66S…
Product Name CART (61-102) (rat) Biological activity CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Oxyntomodulin (bovine, porcine) Biological activity Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist. Formula Formula C192H295N59O60S CAS Number 62340-29-8 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Product Name Orexin B, rat, mouse TFA Biological activity Orexin B, rat, mouse (Rat orexin B) TFA is an endogenous orexin receptor agonist. Orexin B, rat, mouse TFA binds and activates two closely related orphan G protein-coupled receptors OX1-R and OX2-R. Orexin B, rat, mouse TFA stimulates food intake and energy expenditure and plays a…
Product Name CCK (26-31) sulfated Biological activity CCK (26-31) (sulfated) is the N-terminal fragment of CCK, a peptide hormone found in the gut and brain that stimulates digestion, regulates satiety, and is associated with anxiety. CAS Number 89911-65-9 Appearance Solid Color White to off-white Sequence Sequence Ac-Asp-{Tyr(SO3H)}-Met-Gly-Trp-Met-NH2 Sequence Shortening Sequence Shortening Ac-D-{Tyr(SO3H)}-YMGWM-NH2 Storage Sealed storage,…
Product Name SALMF amide 1 Biological activity SALMF amide 1 is a neuropeptide. CAS Number 134439-73-9 Sequence Shortening Sequence Shortening GFNSALMF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Calcitonin (salmon) acetate Biological activity Calcitonin (salmon) (acetate)?is a dual-action amylin and calcitonin?receptor agonist, can stimulate bone formation and inhibit bone resorption.The acetate form can affect the absorption and efficacy of hormones. Formula Formula C145H240N44O48S2.xC2H4O2 CAS Number 158000-61-4 Appearance Solid Color White to off-white Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence…
Product Name CLE25 Peptide Biological activity CLE25 peptide moves from the roots to the leaves and modulates NCED3 expression in leaves in association with the receptor-like kinases BAM1 and BAM3. CLE25 peptide induces stomatal closure by modulating abscisic acid accumulation and thereby enhances resistance to dehydration stress. CAS Number 911319-15-8 Sequence Sequence Arg-Lys-Val-Pro-Asn-Gly-Pro-Asp-Pro-Ile-His-Asn Sequence Shortening…
CHRG01 is a biologically active peptide (CHRG01 is derived from the C-terminal amino acids 54 to 67 of human ??-defensin 3 (hBD3), with all Cys residues replaced by Ser. This substitution removes all disulfide linkages within the sequence. CHRG01, like hBD3, exhibits electrostatic-dependent antibacterial properties). Product Details Product Name CHRG01 Biological activity CHRG01 is a…
Cibinetide (ARA290) is a non-hematopoietic Erythropoietin analog. Cibinetide selectively activates the EPOR/CD131 heteromer IRR without activating EPOR homodimers, and exerts neuroprotective effects through β-common receptor signaling. Cibinetide inhibits Cathepsin K/OSCAR/OC-STAMP/DC-STAMP/NFATC1, increases OPG and Alkaline phosphatase, and decreases CD115. Cibinetide modulates SIRT1/NF-??B/IL-1β signaling, reduces inflammatory infiltration and periapical bone loss, protects pancreatic islets, reduces IBMIR-related platelet…
Cilagicin is a dodecalipopeptide and a Gram-positive-active antibiotic. Cilagicin has a dual polyprenyl phosphate binding mechanism that prevents the development of resistance. Product Details Product Name Cilagicin Biological activity Cilagicin, a dodeca-lipodepsipeptide, is a Gram-positive active antibiotic. Cilagicin has a dual polyprenyl phosphate binding mechanism that impedes resistance development. Storage Please store the product under…
Citrocin is a potent inhibitor of bacterial RNA polymerase (RNAP). Citrocin shows significant inhibitory activity against Escherichia coli RNA polymerase, with MIC values ranging from 16 to 125 ??M. Citrocin specifically binds to RNA polymerase and inhibits its activity, thereby blocking bacterial transcription, and enters cells mainly through the inner membrane protein SbmA. Citrocin is…
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 against human rhinovirus. Citrullinated LL-37 1cit has antibacterial activity against S. aureus. Citrullinated LL-37 1cit can cause a reduction in RV1B-induced IL-8, CCL5, and IL-6 mRNA levels. Product Details Product Name Citrullinated LL-37 1cit Biological…
Citrullinated LL-37 2cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 2cit reduces the activity of LL-37 against HRV at 10 ??g/mL and reduces the antibacterial effect of LL-37. Citrullinated LL-37 2cit causes a reduction in RV1B-induced IL-8, CCL5, and IL-6 mRNA levels. Citrullinated LL-37 2cit shows a moderate decrease in the ability to reduce…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us