Insert HTML here
Showing 977–992 of 3705 results
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Hyalophora Protein Name: Cecropin Purity: >90% (HPLC-MS) Quantification: No Sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 Specifications: 35mer cancer peptide
Cecropin D is an antimicrobial peptide with an MIC of 4.55 ??g/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, anti-tumor, and immunomodulatory effects. Product Details Product Name Cecropin D Biological activity Cecropin D is an antimicrobial peptide with a MIC of 4.55 ??g/mL. Cecropin D is effective…
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the porcine small intestine. Cecropin P1, porcine has antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine has antiviral activity and inhibits PRRSV infection. Product Details Product Name Cecropin P1, porcine Biological activity Cecropin P1, porcine is an antibacterial peptide…
Cecropin P1, porcine acetate is an antibacterial peptide that can be isolated from the upper part of the porcine small intestine. Cecropin P1, porcine acetate has antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine acetate has antiviral activity and inhibits PRRSV infection. Product Details Product Name Cecropin P1, porcine acetate Biological activity Cecropin P1, porcine…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification:…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification:…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Coxsackievirus, Haemophilus influenzae, Helicobacter pylori, Herpes Simplex Virus, Human Adenovirus (HAdV), Human Papillomavirus (HPV), Human herpesvirus 6 (HHV6), Influenza A, JC polyomavirus,…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza, Tetanus Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name:…
Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza, Tetanus Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA class I & II-restricted T-cell epitopes
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA restricted T-cell epitopes
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Selected proteins Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Selected proteins Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…
Cemadotin (LU103793) is a water-soluble synthetic analogue of Dolastatin 15 (HY-P1126) that inhibits cell proliferation in vitro and the growth of tumor xenografts in mice. Cemadotin blocks cells at mitosis, and exhibits Ki value of 1 ??M for inhibiting tubulin. Cemadotin can be used to research anticancer. Product Information Product Name Cemadotin Molecular Weight 640.86…
Cemadotin (LU103793) hydrochloride is a water-soluble synthetic analogue of Dolastatin 15 (HY-P1126) that inhibits cell proliferation in vitro and the growth of tumor xenografts in mice. Cemadotin hydrochloride blocks cells at mitosis, and exhibits Ki value of 1 ??M for inhibiting tubulin. Cemadotin hydrochloride can be used to research anticancer. Product Information Product Name Cemadotin…
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be…
Cephabacin M4 is one of the components of cephabacins and is a 7-methoxy deacetoxycephalosporin. Cephabacin M4 can be isolated from the culture filtrate of Xanthomonas lactamogenes. Product Details Product Name Cephabacin M4 Biological activity Cephabacin M4 is a cephalosporin component, a 7-methoxydesacetylcephalosporin. Cephabacin M4 can be isolated from the culture filtrate of Xanthomonas lactamica. Sequence…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us