Insert HTML here
Showing 961–976 of 3705 results
CBP-1018 is a PDC (peptide-drug conjugate) formed by conjugating Monomethyl auristatin E (HY-15162) with a FLOR1/PSMA (prostate-specific membrane antigen) dual-targeting ligand via a linker (HY-78738). CBP-1018 binds FLOR1 and prostate-specific membrane antigen (PSMA). CBP-1018 can be used in research on solid tumors and metastatic castration-resistant prostate cancer. Product Details Product Name CBP-1018 Biological activity CBP-1018…
CBP-501, a cell-permeable calmodulin-binding peptide and a G2-abrogating drug candidate, inhibits the activity of multiple Ser216-specific kinases, such as MAPKAP-K2, C-Tak1, CHK1 and CHK2, with IC50 values of 0.9 ??M, 1.4 ??M 3.4 ??M and 6.5 ??M, respectively. CBP-501 is used for various types of cancer. Product Information Product Name CBP-501 Molecular Weight 1929.06 Formula…
CBP-501 acetate, a cell-permeable calmodulin-binding peptide and a G2-abrogating drug candidate, inhibits the activity of multiple Ser216-specific kinases, such as MAPKAP-K2, C-Tak1, CHK1 and CHK2, with IC50 values of 0.9 ??M, 1.4 ??M 3.4 ??M and 6.5 ??M, respectively. CBP-501 acetate is used for various types of cancer. Product Information Product Name CBP-501 acetate Molecular…
Product Name Endothelin (16-21) Biological activity Endothelin (16-21) is a selective ETB receptor agonist (EC50=228 nM in guinea-pig bronchus). Endothelin (16-21) can induce smooth muscle contraction. Endothelin (16-21) is promising for research of respiratory (e.g., asthma) and cardiovascular (e.g., hypertension) diseases. CAS Number 121377-67-1 Sequence Sequence His-Leu-Asp-Ile-Ile-Trp Sequence Shortening Sequence Shortening HLDIIW Storage Please store…
Product Name me4 Peptide Biological activity me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders. Sequence Sequence Ac-Ala-Arg-Thr-Tyr-Gly-Arg-Arg-Arg-Gly-Ser-Gly-Ser-Gly-Ser-Ala-Arg-Thr-Tyr-Gly-Arg-Arg-Arg-NH2 Sequence Shortening Sequence Shortening Ac-ARTYGRRRGSGSGSARTYGRRR-NH2 Storage Please store the…
Product Name CART (55-76), rat Biological activity CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and…
Product Name CART (1-39), Human Biological activity CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART…
Product Name [Lys0]γ1-MSH Biological activity γ1-MSH is a γ1-melanotropin-like peptide, one of 1600-dalton γ-MSHs. γ1-MSH can be isolated from bovine neurointermediate pituitary lobes. Formula Formula C78H109N23O15S CAS Number 78859-45-7 Sequence Shortening Sequence Shortening KYVMGHFRWDRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
CEC-2-9 is a polypeptide with the sequence Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2. Product Details Product Name CEC-2-9 Biological activity CEC-2-9 is a polypeptide with the sequence Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2. Sequence Shortening Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Cecropin A is a linear polypeptide composed of 37 amino acids, with antibacterial, anti-tumor and anti-inflammatory activities. Product Details Product Name Cecropin A Biological activity Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity. Formula C184H313N53O46 CAS Number 80451-04-3 Appearance Solid Color White to off-white Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 Sequence Shortening KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Storage…
Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide with antibacterial activity against a broad spectrum of Gram-positive and Gram-negative aerobic bacteria, as well as antimalarial activity, and lacks the adverse hemolytic properties of melittin. Product Details Product Name Cecropin A (1-7)-Melittin A (2-9) Biological activity Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide…
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Insect Protein Name: Cecropin Purity: >95% (HPLC-MS) Quantification: No Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Specifications: Antimicrobial peptide
Cecropin A TFA is a linear antimicrobial peptide composed of 37 amino acid residues obtained from Hyalophora cecropia pupae, with antibacterial, anti-inflammatory, and anticancer effects. Product Details Product Name Cecropin A TFA Biological activity Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory and…
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Hyalophora Protein Name: Cecropin Purity: >90% (HPLC-MS) Quantification: No Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Specifications: 37mer cancer peptide
Cecropin B possesses a high level of antibacterial activity and is a valuable peptide antibiotic. Product Details Product Name Cecropin B Biological activity Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic. Molecular Weight 3834.67 Formula C176H302N52O41S CAS Number 80451-05-4 Appearance Solid Color White to off-white Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2…
Cecropin B (free acid) is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us