Citrullinated LL-37 1cit
Description
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 against human rhinovirus. Citrullinated LL-37 1cit has antibacterial activity against S. aureus. Citrullinated LL-37 1cit can cause a reduction in RV1B-induced IL-8, CCL5, and IL-6 mRNA levels.
Product Details
| Product Name | Citrullinated LL-37 1cit |
| Biological activity | Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B. |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-{Cit}-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | LLGDFF-{Cit}-KSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
