Skip to content
QYAOBIO logo
  • PeptideExpand
    • Custom Peptide SynthesisExpand
      • Antigenic Peptides
      • Antimicrobial Peptides
      • Cell Penetrating Peptide
      • Click Chemistry Peptides
      • Cyclic Peptide
      • Fluorescent Peptides
      • FRET Peptide
      • Glycopeptides
      • Isotope Labeled Peptides
      • Lipopeptide
      • Long Peptide Synthesis
      • Peptide Library
      • Peptoid
      • Stapled Peptide
      • Unnatural Amino Acids
    • Peptide ModificationExpand
      • C-terminal Modification
      • N-terminal Modification
      • Peptide Biotinylation
      • Peptide Conjugation
      • Peptide Linker
      • Peptide Pegylation
      • Peptide Phosphorylation
      • Peptide Prenylation
      • Peptide Sulphation
      • Peptide Tags
    • Catalog Peptides
    • Custom Peptide Quote
  • AntibodyExpand
    • Polyclonal Antibody Production
    • Monoclonal Antibody Production
    • Recombinant Antibody Production
    • Antibody Pairing
    • Antibody CatalogExpand
      • Monoclonal Antibodies
      • Polyclonal Antibodies
      • Recombinant Antibodies
      • Secondary Antibodies
      • Loading Control Antibodies
      • Isotype Control Antibodies
      • Small Molecule Antibodies
      • Tag Antibodies
    • Custom Monoclonal Antibody
  • ProteinExpand
    • Protein ExpressionExpand
      • Mammalian Protein Expression
      • Insect Protein Expression
      • Bacterial Protein Expression
      • Yeast Protein Expression
      • Cell-Free Protein Expression
    • Protein PurificationExpand
      • Affinity Chromatography
      • Ion Exchange Chromatography
      • Size Exclusion Chromatography
      • Hydrophobic Interaction Chromatography
      • Mixed Mode Chromatography
      • Reversed Phase Liquid Chromatography
    • Protein CatalogExpand
      • Native Proteins
      • Active Proteins
      • Recombinant Proteins
      • Membrane Proteins
  • ResourceExpand
    • Blog
    • Citations
    • Policy
    • Statement
  • About
Contact
WhatsApp WhatsAppLinkedin LinkedinFacebook Facebook

QYAOBIO logo
WhatsApp Linkedin Facebook
Contact
Home / store / peptides / Cecropin A Peptide
Cecropin A Peptide

Cecropin A Peptide

Category: peptides
  • Description

Description

Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Specifications: Antimicrobial peptide

Related products

  • A21G-Beta-Amyloid (1-42) HFIP treated

    A21G-Beta-Amyloid (1-42) HFIP treated

    Read moreContinue Loading Done
  • Antigen Peptide BCL 2 HLA-A*0201 (WLSLKTLLSL)

    Antigen Peptide BCL 2 HLA-A*0201 (WLSLKTLLSL)

    Read moreContinue Loading Done
  • Acetylome - Acetyltransferase Microarray

    Acetylome – Acetyltransferase Microarray

    Read moreContinue Loading Done
  • Anoplin Peptide

    Anoplin Peptide

    Read moreContinue Loading Done

ATTENTIVE, INNOVATIVE, WORLD CLASS

Peptide

  • Custom Peptide Synthesis
  • Peptide Modification
  • Catalog Peptides
  • Custom Peptide Quote

Antibody

  • Monoclonal Antibody Production
  • Polyclonal Antibody Production
  • Recombinant Antibody Production

Protein

  • Protein Expression
  • Protein Purification
  • Protein Catalog

© 2026 QYAOBIO

ChinaPeptides CO., Ltd.

Scroll to top

QYAOBIO

Typically replies within minutes

Any questions related to Cecropin A Peptide?

WhatsApp Us

Online | Privacy policy

WhatsApp us

  • Peptide
    • Custom Peptide Synthesis
      • Antigenic Peptides
      • Antimicrobial Peptides
      • Cell Penetrating Peptide
      • Click Chemistry Peptides
      • Cyclic Peptide
      • Fluorescent Peptides
      • FRET Peptide
      • Glycopeptides
      • Isotope Labeled Peptides
      • Lipopeptide
      • Long Peptide Synthesis
      • Peptide Library
      • Peptoid
      • Stapled Peptide
      • Unnatural Amino Acids
    • Peptide Modification
      • C-terminal Modification
      • N-terminal Modification
      • Peptide Biotinylation
      • Peptide Conjugation
      • Peptide Linker
      • Peptide Pegylation
      • Peptide Phosphorylation
      • Peptide Prenylation
      • Peptide Sulphation
      • Peptide Tags
    • Catalog Peptides
    • Custom Peptide Quote
  • Antibody
    • Polyclonal Antibody Production
    • Monoclonal Antibody Production
    • Recombinant Antibody Production
    • Antibody Pairing
    • Antibody Catalog
      • Monoclonal Antibodies
      • Polyclonal Antibodies
      • Recombinant Antibodies
      • Secondary Antibodies
      • Loading Control Antibodies
      • Isotype Control Antibodies
      • Small Molecule Antibodies
      • Tag Antibodies
    • Custom Monoclonal Antibody
  • Protein
    • Protein Expression
      • Mammalian Protein Expression
      • Insect Protein Expression
      • Bacterial Protein Expression
      • Yeast Protein Expression
      • Cell-Free Protein Expression
    • Protein Purification
      • Affinity Chromatography
      • Ion Exchange Chromatography
      • Size Exclusion Chromatography
      • Hydrophobic Interaction Chromatography
      • Mixed Mode Chromatography
      • Reversed Phase Liquid Chromatography
    • Protein Catalog
      • Native Proteins
      • Active Proteins
      • Recombinant Proteins
      • Membrane Proteins
  • Resource
    • Blog
    • Citations
    • Policy
    • Statement
  • About