Insert HTML here
Showing 945–960 of 3705 results
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way. Product Information Product Name Carperitide Molecular Weight 3080.44 Formula…
Product Name GLP-1(7-36), amide TFA Biological activity GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Molecular Weight 3297.63 (free base) Formula Formula C149H226N40O45.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage Sealed storage, away from moisture and light Powder -80??C…
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way. Product Information Product Name Carperitide acetate Molecular Weight 3140.50 Formula C129H207N45O41S3 CAS Number…
Product Name Acyline Biological activity Acyline, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels. Molecular Weight 1533.21 Formula Formula C80H102ClN15O14 CAS Number 170157-13-8 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
Product Name Cardioexcitatory peptide 1 Biological activity Cardioexcitatory peptide 1 is a cardioexcitatory neuropeptide, can be isolated from Achatina atria. Cardioexcitatory peptide 1 has potent cardio-excitatory action on the hearts and also modifies the motility of muscular tissues and neural activities. Formula Formula C57H85N21O15 CAS Number 127122-98-9 Sequence Shortening Sequence Shortening SGQSWRPQGRF-NH2 Storage Please store…
Product Name ACTH (6-9) Biological activity ACTH (6-9) (MSH-ACTH tetrapeptide) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. Formula…
Product Name VIP(Guinea pig) Biological activity VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function. Formula Formula C147H239N43O42S2 CAS Number 96886-24-7 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 Sequence Shortening…
Product Name Obestatin(rat) Biological activity Obestatin(rat), encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) has anti-inflammatory, anti-myocardial infarction and antioxidant activities. CAS Number 869705-22-6 Appearance Solid Color…
Product Name Brain Natriuretic Peptide-45, mouse Biological activity Brain Natriuretic Peptide-45, mouse (BNP-45, mouse) is a 45-amino-acid peptide derived from the mouse BNP prohormone, which exhibits natriuretic, diuretic, and vasoactive effects. Brain Natriuretic Peptide-45, mouse contains all amino acid residues deemed critical for the biological activity of natriuretic peptides. Brain Natriuretic Peptide-45, mouse possesses hypotensive…
Product Name CART(55-102)(human) TFA Biological activity CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y. Sequence Sequence Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GLP-2(rat) Biological activity GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Formula Formula C166H256N44O56S CAS Number 195262-56-7 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Sequence Shortening Sequence Shortening HADGSFSDEMNTILDNLATRDFINWLIQTKITD Storage…
Product Name CART(55-102)(rat) TFA Biological activity CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior. Sequence Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Please store the product under the recommended…
Cathelicidin-2 chicken is an antimicrobial peptide. Cathelicidin-2 chicken has strong bactericidal and fungicidal activity against chicken-specific Salmonella isolates. Product Details Product Name Cathelicidin-2 (chicken) Biological activity Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates. Sequence Arg-Phe-Gly-Arg-Phe-Leu-Arg-Lys-Ile-Arg-Arg-Phe-Arg-Pro-Lys-Val-Thr-Ile-Thr-Ile-Gln-Gly-Ser-Ala-Arg-Phe-NH2 Sequence Shortening RFGRFLRKIRRFRPKVTITIQGSARF-NH2 Storage Please store the product under the…
Cathelicidin-PY is an antimicrobial peptide with potent antimicrobial activity. Cathelicidin-PY inhibits the activation of the lipopolysaccharide (LPS) (HY-D1056)-induced TLR4 inflammatory pathway. Cathelicidin-PY has strong antibacterial and anti-inflammatory activities and low cytotoxicity against RAW 264.7 cells. Cathelicidin-PY can be used in antibacterial and anti-inflammatory research. Product Details Product Name Cathelicidin-PY Biological activity Cathelicidin-PY is an antimicrobial…
Cathepsin G(1-5) is an antimicrobial peptide present in a clostripain-digested cathepsin G mixture. Product Details Product Name Cathepsin G(1-5) Biological activity Cathepsin G(1-5) is an antimicrobial peptide that can be found in the clostripain-digested cathepsin G mixture. Sequence Ile-Ile-Gly-Gly-Arg Sequence Shortening IIGGR Storage Please store the product under the recommended conditions in the Certificate of…
CBLB 612 is an anti-radiation agent. CBLB 612 can be used in the propagation of mouse and monkey moderate stimulation hematopoietic stem cell (HSC), and lure that they are passed to peripheral blood from bone marrow into. CBLB 612 is an important auxiliary agent for cancer. Product Information Product Name CBLB 612 Molecular Weight 1659.03…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us