Lacripep is a synthetic tear protein. Lacripep binds to and activates syndecan-1 (SDC1). Lacripep restores progenitor cell identity and epithelial barrier function. Lacripep resolves dry eye. Product Information Product Name Lacripep Molecular Weight 2283.62 Formula C106H167N27O29 CAS Number 2243095-21-6 Appearance Solid Color White to off-white Sequence Ac-Lys-Gln-Phe-Ile-Glu-Asn-Gly-Ser-Glu-Phe-Ala-Gln-Lys-Leu-Leu-Lys-Lys-Phe-Ser-NH2 Sequence Shortening Ac-KQFIENGSEFAQKLLKKFS-NH2 Storage Sealed storage, away from…
Lagatide (BN 52080), a heptapeptide, is a short C-terminal analog of sorbin. Lagatide has proabsorptive and antisecretory effect in the different parts of the intestine. Lagatide can be used for the research of chronic diarrhea. Product Information Product Name Lagatide Molecular Weight 738.88 Formula C33H58N10O9 CAS Number 157476-77-2 Sequence Pro-Val-Thr-Lys-Pro-Gln-d-Ala-NH2 Sequence Shortening PVTKPQA-NH2
Lanreotide (BIM 23014) is a somatostatin analogue with antineoplastic activity. Lanreotide can be used for the research of carcinoid syndrome. Product Information Product Name Lanreotide Molecular Weight 1096.32 Formula C54H69N11O10S2 CAS Number 108736-35-2 Appearance Solid Color White to off-white Sequence Shortening {d-2nal}-CY-{d-Trp}-KVCT-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-2nal}-CY-{d-Trp}-KVCT-NH2 (Disulfide bridge: Cys2-Cys7) Storage Sealed storage, away…
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome. Product Information Product Name Lanreotide acetate Molecular Weight 1156.38 Formula C56H73N11O12S2 CAS Number 2378114-72-6 Appearance Solid Color White to off-white Sequence {d-2nal}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Thr-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-2nal}-CY-{d-Trp}-KVCT-NH2 (Disulfide bridge: Cys2-Cys7) Storage Sealed…
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome. Product Information Product Name Lanreotide diTFA Molecular Weight 1324.37 Formula C58H71F6N11O14S2 CAS Number 1024499-83-9 Sequence Shortening {d-2nal}-CY-{d-Trp}-KVCT-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-2nal}-CY-{d-Trp}-KVCT-NH2 (Disulfide bridge: Cys2-Cys7)
Latromotide is a synthetic peptide with antineoplastic activity. It consists of 10 amino acids corresponding to amino acid residues 66-75 of the human kinesin-like protein KIF20A. Latromotide has a sequence of H-Lys-Val-Tyr-Leu-Arg-Val-Arg-Pro Leu-Leu-OH. Product Information Product Name Latromotide Molecular Weight 1256.58 Formula C60H105N17O12 CAS Number 1049674-65-8 Sequence Lys-Val-Tyr-Leu-Arg-Val-Arg-Pro-Leu-Leu Sequence Shortening KVYLRVRPLL
Lecirelin, a synthetic gonadotropin-releasing hormone (GnRH) analogue, acts as a GnRH agonist. Lecirelin is widely used for the research of bovine ovarian follicular cysts. Product Information Product Name Lecirelin Molecular Weight 1209.40 Formula C59H84N16O12 CAS Number 61012-19-9 Appearance Solid Color White to off-white Sequence {Glp}-His-Trp-Ser-Tyr-Val-Leu-Arg-Pro Sequence Shortening {Glp}-HWSYVLRP Storage Sealed storage, away from moisture Powder…
Lefleuganan is a potent antiprotozoal agent. Product Information Product Name Lefleuganan Molecular Weight 1180.54 Formula C62H102FN11O10 CAS Number 2233558-98-8
Lenbelintide is a dual amylin/calcitonin receptor agonist. Lenbelintide can be studied in research on obesity. Product Information Product Name Lenbelintide Molecular Weight 4590.15 Formula C202H319N55O63S2 CAS Number 2793341-99-6 Sequence {Lys-(γGlu-γGlu-C18 diacid)}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-{(α-Me-Phe)}-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Glu-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7) Sequence Shortening {Lys-(γGlu-γGlu-C18 diacid)}-CNTATCATQRLANFLRHSSNN-{(α-Me-Phe)}-GPILPPTEVGSNTY-NH2 (disulfide bridge:Cys2-Cys7)
LEP(116-130)(mouse) is a synthetic leptin peptide fragment. Product Information Product Name LEP(116-130)(mouse) Molecular Weight 1560.73 Formula C64H109N19O24S CAS Number 258276-95-8 Appearance Solid Color White to off-white Sequence Ser-Cys-Ser-Leu-Pro-Gln-Thr-Ser-Gly-Leu-Gln-Lys-Pro-Glu-Ser-NH2 Sequence Shortening SCSLPQTSGLQKPES-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage,…
Linaclotide is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation. Product Information Product Name Linaclotide Molecular Weight 1526.74 Formula C59H79N15O21S6 CAS Number 851199-59-2 Appearance Solid Color White to off-white Sequence Cys-Cys-Glu-Tyr-Cys-Cys-Asn-Pro-Ala-Cys-Thr-Gly-Cys-Tyr (disulfide bridge:Cys1-Cys6,Cys2-Cys10,Cys5-Cys13) Sequence Shortening CCEYCCNPACTGCY (disulfide bridge:Cys1-Cys6,Cys2-Cys10,Cys5-Cys13) Storage Sealed storage, away…
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation. Product Information Product Name Linaclotide acetate Molecular Weight 1586.79 Formula C61H83N15O23S6 CAS Number 851199-60-5 Appearance Solid Color White to off-white Sequence Cys-Cys-Glu-Tyr-Cys-Cys-Asn-Pro-Ala-Cys-Thr-Gly-Cys-Tyr (disulfide bridge: Cys1-Cys6; Cys2-Cys10; Cys5-Cys13) Sequence Shortening CCEYCCNPACTGCY (disulfide…
Linvixdutide is a glucagon and glucagon-like peptide 1 receptor (GLP-1R) agonist with anti-obesity effects. Product Information Product Name Linvixdutide Molecular Weight 4939.49 Formula C228H342N56O67 CAS Number 3056608-44-4 Sequence His-{Aib}-His-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ala-Lys-Arg-Ala-Gln-Glu-Phe-Ile-Glu-Trp-Leu-Leu-Gln-Ser-Gln-Gln-His-Glu-Ser-Pro-Pro-Pro{Lys(γGlu-C20 diacid)} Sequence Shortening H-{Aib}-HGTFTSDYSKYLDAKRAQEFIEWLLQSQQHESPPP{K(γGlu-C20 diacid)}
Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus. Product Information Product Name Liraglutide Molecular Weight 3751.20 Formula C172H265N43O51 CAS Number 204656-20-2 Appearance Solid Color White to off-white Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-{Lys(γGlu-C16 acid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening HAEGTFTSDVSSYLEGQAA-{Lys(γGlu-C16 acid)}-EFIAWLVRGRG Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C…
Liraglutide acetate is the acetate form of Liraglutide (HY-P0014), a glucagon-like peptide-1 (GLP-1) receptor agonist studied in type 2 diabetes. Product Information Product Name Liraglutide acetate Molecular Weight 3751.20 (free base) Formula C172H265N43O51.xC2H4O2 CAS Number 1997361-86-0 Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-{Lys(γGlu-C16 acid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening HAEGTFTSDVSSYLEGQAA-{Lys(γGlu-C16 acid)}-EFIAWLVRGRG
Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis,…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
