Insert HTML here
Showing 449–464 of 490 results
Trofinetide (NNZ-2566), a synthetic analogue of the endogenous N-terminus tripeptide, Glycine-Proline-Glutamate (GPE), has been shown to be neuroprotective in animal models of brain injury. Product Information Product Name Trofinetide Molecular Weight 315.32 Formula C13H21N3O6 CAS Number 853400-76-7 Appearance Solid Color White to off-white Sequence Gly-{Pro(α-Me)}-Glu Sequence Shortening G{Pro(α-Me)}E Storage Sealed storage, away from moisture and…
TRV120027, a β-arrestin-1-biased agonist of the angiotensin II receptor type 1 (AT1R), engages β-arrestins while blocking G-protein signaling. TRV120027 induces acute catecholamine secretion through cation channel subfamily C3 (TRPC3) coupling, promotes the formation of a macromolecular complex composed of AT1R-β-arrestin-1-TRPC3-PLCγ at the plasma membrane. TRV120027 inhibits angiotensin II-mediated vasoconstriction and increases cardiomyocyte contractility. TRV120027 has…
TRV120027 TFA, a β-arrestin-1-biased agonist of the angiotensin II receptor type 1 (AT1R), engages ?-arrestins while blocking G-protein signaling. TRV120027?TFA induces?acute?catecholamine?secretion?through cation channel subfamily C3 (TRPC3) coupling, promotes the formation of a macromolecular complex composed of AT1R?Cβ-arrestin-1?CTRPC3?CPLCγ at the plasma membrane. TRV120027 TFA inhibits angiotensin II?Cmediated vasoconstriction and increases cardiomyocyte contractility. TRV120027 TFA has the…
TT-232 (CAP-232), a somatostatin derivative, is a peptide SSTR1/SSTR4 agonist. TT-232 inhibits cancer cell proliferation and induces apoptosis. TT-232 is also a broad-spectrum anti-inflammatory and analgesic agent. Product Information Product Name TT-232 Molecular Weight 947.13 Formula C45H58N10O9S2 CAS Number 147159-51-1 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture and light, under…
Tyrosylleucine (Tyr-Leu, YL), an orally active dipeptide, exhibits a potent antidepressant-like activity. Product Information Product Name Tyrosylleucine Molecular Weight 294.35 Formula C15H22N2O4 CAS Number 17355-10-1 Appearance Solid Color White to off-white Sequence Tyr-Leu Sequence Shortening YL Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
Tyrosylleucine (Tyr-Leu, YL) TFA, an orally active dipeptide, exhibits a potent antidepressant-like activity. Product Information Product Name Tyrosylleucine TFA Molecular Weight 408.37 Formula C17H23F3N2O6 CAS Number 66852-01-5 Appearance Solid Color White to off-white Sequence Tyr-Leu Sequence Shortening YL Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure. Product Information Product Name Ularitide Molecular Weight 3505.96 Formula C145H234N52O44S3 CAS Number 118812-69-4 Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27) Sequence Shortening TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)
Urcosimod (OK 101) is a lipid-coupled chemokine peptide, a ChemR23 G protein-coupled receptor agonist, which has been shown to have anti-inflammatory and analgesic activities. Urcosimod can be used for dry eye research. Product Information Product Name Urcosimod Molecular Weight 1994.37 Formula C101H152N14O27 CAS Number 1610366-43-2 Appearance Solid Color White to off-white Sequence {(C16 acid-PEG8)-Gly}-Gly-{dTyr}-Phe-Leu-Pro-{dSer}-Gln-Phe-{dAla}-{L-Porretine}-Ser Sequence…
Urocortin II, human is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human has an effect of promoting satiet and neuroprotective effect. Urocortin II, human also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human can reduce pulmonary arterial…
Urocortin II, human acetate is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human acetate has an effect of promoting satiet and neuroprotective effect. Urocortin II, human acetate also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human acetate can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human…
Urocortin II, human TFA is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. Urocortin II, human TFA has an effect of promoting satiet and neuroprotective effect. Urocortin II, human TFA also has bactericidal, antiparasitic and pro-inflammation activity. Urocortin II, human TFA can activate NF-??B pathway and ERK1/2 MAP kinase. Urocortin II, human…
Urofollitropin is a protein extract of human menopausal urine. Urofollitropin has the function of promoting follicle development and maturation, but contains very small amounts of urinary proteins. Product Information Product Name Urofollitropin CAS Number 97048-13-0
Vapreotide is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM. Product Information Product Name Vapreotide Molecular Weight 1131.37 Formula C57H70N12O9S2 CAS Number 103222-11-3 Appearance Solid Color White to off-white Sequence {d-Phe}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Trp-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-Phe}-CY-{d-Trp}-KVCW-NH2 (Disulfide bridge: Cys2-Cys7) Storage Sealed storage, away from moisture and light Powder -80??C 2 years…
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM. Product Information Product Name Vapreotide acetate Molecular Weight 1191.42 Formula C59H74N12O11S2 CAS Number 849479-74-9 Appearance Solid Color White to off-white Sequence {d-Phe}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Trp-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-Phe}-CY-{d-Trp}-KVCW-NH2 (Disulfide bridge: Cys2-Cys7) Storage Sealed storage, away from moisture…
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM. Product Information Product Name Vapreotide diacetate Molecular Weight 1251.47 Formula C61H78N12O13S2 CAS Number 936560-75-7 Sequence {d-Phe}-Cys-Tyr-{d-Trp}-Lys-Val-Cys-Trp-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening {d-Phe}-CY-{d-Trp}-KVCW-NH2 (Disulfide bridge: Cys2-Cys7)
Veldoreotide (DG3173) a somatostatin analogue, binds to and activate the somatostatin receptors (SSTR) 2, 4, and 5. Veldoreotide inhibits growth hormone (GH) secretion in adenomas compared withOctreotide (HY-P0036). Veldoreotide has the potential to be used as pain modulating agent Product Information Product Name Veldoreotide Molecular Weight 1123.30 Formula C60H74N12O10 CAS Number 252845-37-7
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Therapeutic Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us