Insert HTML here
Showing 465–480 of 490 results
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively. Product Information Product Name Velmupressin Molecular Weight 946.58 Formula C42H60ClN11O8S2 CAS Number 1647119-61-6
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) acetate is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively. Product Information Product Name Velmupressin acetate Molecular Weight 1006.63 Formula C44H64ClN11O10S2 CAS Number 1647120-04-4 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2…
Vensemaglutide is the agonist for glucagon-like peptide 1 (GLP-1) receptor. Vensemaglutide can be used in research of diabetes or other metabolic disorders. Product Information Product Name Vensemaglutide Molecular Weight 4668.25 Formula C214H337N49O67 CAS Number 2919344-88-8 Sequence Gly-Gly(C2-NH2-γGlu-C16 acid)-His-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(γGlu-AEEA-AEEA-C18 diacid)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening G-Gly(C2-NH2-γGlu-C16 acid)-H-{Aib}-EGTFTSDVSSYLEGQAA-Lys(γGlu-AEEA-AEEA-C18 diacid)-EFIAWLVRGRG
Ventegatide is an integrin-binding peptide that can be used for the study of osteoarthritis. Product Information Product Name Ventegatide Molecular Weight 2537.61 Formula C107H161N31O41 CAS Number 478496-41-2 Sequence Thr-Asp-Leu-Gln-Glu-Arg-Gly-Asp-Asn-Asp-Ile-Ser-Pro-Phe-Ser-Gly-Asp-Gly-Gln-Pro-Phe-Lys-Asp-NH2 Sequence Shortening TDLQERGDNDISPFSGDGQPFKD-NH2
Vezocolmitide (ST-100) is a collagen mimetic peptide. Vezocolmitide can rapidly repair damaged collagen triple helix structures, thereby quickly reversing damage to the ocular surface and extracellular matrix, and restoring corneal nerve function while repairing the epithelium. Vezocolmitide can be used for research of dry eye disease (DED). Product Information Product Name Vezocolmitide Molecular Weight 1776.99…
Vicatertide (SB-01, Peniel 2000) is a polypeptide with both competitive inhibitory activity against TGF-β1 and selective inhibitory activity against human factor XIa (hFXIa, with a Ka of 80 nM for hFXIa). Vicatertide binds allosterically to the two binding sites of dimeric hFXI/hFXIa, while directly binding to activated TGF-β1, selectively blocking the Smad1/5/8 pathway and maintaining…
Vorumotide is an immunological agent for active immunization as well as an antineoplastic agent. Product Information Product Name Vorumotide Molecular Weight 2626.03 Formula C114H181N39O29S2 CAS Number 935395-34-9 Sequence Pro-Gly-Cys-Asn-Lys-Arg-Tyr-Phe-Lys-Leu-Ser-His-Leu-Gln-Met-His-Ser-Arg-Lys-His-Thr-Gly Sequence Shortening PGCNKRYFKLSHLQMHSRKHTG
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research. Product Information Product Name Vosoritide Molecular Weight 4102.73 Formula C176H290N56O51S3 CAS Number 1480724-61-5 Appearance Solid…
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth. Product Information Product Name Vosoritide acetate Molecular Weight 4162.78 Formula C176H290N56O51S3.C2H4O2 Appearance Solid Color White to off-white Sequence Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) Sequence Shortening PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39) Storage Sealed storage, away…
WAY-181187 (SAX-187) oxalate is a potent and selective full 5-HT6 receptor agonist with a Ki of 2.2 nM and an EC50 of 6.6 nM. WAY-181187 oxalate mediates 5-HT6 receptor-dependent signal pathways, such as cAMP, Fyn and ERK1/2 kinase, as specific agonist. Product Information Product Name WAY-181187 oxalate Molecular Weight 470.91 Formula C17H15ClN4O6S2 CAS Number 1883548-85-3
wrwyar-NH2 (TFA) is a control peptide for wrwycr-NH2 (HY-P10930A). Product Information Product Name wrwyar-NH2 TFA Molecular Weight 936.07 (free base) Formula C46H61N15O7.xC2HF3O2 Appearance Solid Color White to off-white Sequence d{Trp-Arg-Trp-Tyr-Ala-Arg}-NH2 Sequence Shortening d{Trp-Arg-Trp-Tyr-Ala-Arg}-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month…
wrwycr-NH2 (TFA) is a peptide. wrwycr-NH2 (TFA) is cytotoxic to multiple cancer cells, can induce DNA damage and cell cycle arrest, but does not induce endoplasmic reticulum stress. wrwycr-NH2 (TFA) has anti-tumor activity, and it shows better efficacy when used in combination with DNA-damaging agents. Product Information Product Name wrwycr-NH2 TFA Molecular Weight 968.14 (free…
Xaranetide is a polypeptide with neuroprotective effects. Product Information Product Name Xaranetide Molecular Weight 2829.36 Formula C108H218N72O19 CAS Number 3062244-70-3 Sequence d-{Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg} Sequence Shortening d-{RRRRRRRRRRRRRRRRRR}
Xenopsin-Related Peptide 2 (XP-2) is an avian counterpart to amphibian Xenopsin (HY-P0253). Xenopsin-Related Peptide 2 displays abilities to release histamine from isolated rat mast cells and is as effective as syntheticBradykinin (HY-P0206). Product Information Product Name Xenopsin-Related Peptide 2 Molecular Weight 1193.44 Formula C60H88N16O10 CAS Number 117442-29-2 Sequence Shortening FHPKRPWIL Sequence Shortening FHPKRPWIL
XMP-629 (XOMA-629), a cationic α-helical peptide, is a potent endotoxin inhibitor. XMP-629 exhibits broad-spectrum antimicrobial activity via an immunomodulatory mechanism. XOMA 629 has antimicrobial activity against Propionibacterium acnes, Staphylococcus aureus and Streptococcus pyogenesand. Product Information Product Name XMP-629 Molecular Weight 1284.55 Formula C67H93N15O11 CAS Number 316805-65-9
YHIEPV (rALP-2, Rubisco anxiolytic-like peptide 2) is a potent and orally active peptide. YHIEPV shows anxiolytic effects. YHIEPV increases leptin sensitivity to exert its anti-obesity effects. Product Information Product Name YHIEPV Molecular Weight 756.85 Formula C36H52N8O10 CAS Number 2243939-21-9 Appearance Solid Color White to off-white Sequence Tyr-His-Ile-Glu-Pro-Val Sequence Shortening YHIEPV Storage Sealed storage, away from…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Therapeutic Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us