Therapeutic Peptides

Glepaglutide (ZP1848) acetate, a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide acetate reduces faecal output and increases intestinal absorption. Glepaglutide acetate alleviates small intestinal inflammation. Glepaglutide acetate can be used in the research of inflammatory bowel disease (IBD) and Crohn??s disease. Product Information Product Name Glepaglutide acetate Molecular Weight 4376.06 Formula C199H329N53O57 Appearance…

GLP-1 moiety from Dulaglutide (-GLP-1 (7-37)) is a 31-amino acid fragment derived from Dulaglutide (HY-P0120). GLP-1 moiety from Dulaglutide is a DPP-4-modified GLP-1 analog carrying the sequence mutation, which acts as a GLP-1 receptor agonist. GLP-1 moiety from Dulaglutide covalently links to the human IgG4 Fc fragment and constitutes a part of the dulaglutide recombinant…

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor. Product Information Product Name Glucagon-like peptide 1 (1-37), human Molecular Weight 4169.48 Formula C186H275N51O59 CAS Number 87805-34-3 Appearance Solid Color White to off-white Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year…

Glutathione oxidized (L-Glutathione oxidized) is produced by the oxidation of glutathione. Detoxification of reactive oxygen species is accompanied by production of glutathione oxidized. Glutathione oxidized can be used for the research of sickle cells and erythrocytes. Product Information Product Name Glutathione oxidized Molecular Weight 612.63 Formula C20H32N6O12S2 CAS Number 27025-41-8 Appearance Solid Color White to…

Glycyl-L-alpha-amino-epsilon-pimelyl-D-alanyl-D-alanine (N–D-alanyl-D-alanine) serves as a substrate for Streptomyces R61 D-alanyl-D-alanine peptidase (DD-peptidase). Product Information Product Name Glycyl-L-alpha-amino-epsilon-pimelyl-D-alanyl-D-alanine Molecular Weight 374.39 Formula C15H26N4O7 CAS Number 306748-45-8

Goralatide is a compound that regulates the thermal sensitivity of hematopoietic progenitor cells. It can reduce the thermal sensitivity of normal hematopoietic progenitor cells and increase the difference in thermal sensitivity between leukemia progenitor cells and normal progenitor cells, thereby increasing the inhibition window of hyperthermia therapy. Product Information Product Name Goralatide Molecular Weight 487.50…

Gosteganan is an antimicrobial agent. Product Information Product Name Gosteganan Molecular Weight 2035.52 Formula C103H159N25O18 CAS Number 1342808-13-2 Sequence Ac-d{Phe-Lys-Lys-Leu-Lys-Lys-Leu-Phe-Ser-Lys-Leu-Trp-Asn-Trp-Lys}-NH2 Sequence Shortening Ac-d{FKKLKKLFSKLWNWK}-NH2

Hepcidin-25 (human) is an iron metabolism regulator and Antimicrobial agent. Hepcidin-25 (human) exerts anti-inflammatory and antimicrobial activities by regulating iron-mediated oxidative damage. Product Information Product Name Hepcidin-25 (human) Molecular Weight 2789.35 Formula C113H170N34O31S9 CAS Number 1356390-47-0 Sequence Asp-Thr-His-Phe-Pro-Ile-Cys-Ile-Phe-Cys-Cys-Gly-Cys-Cys-His-Arg-Ser-Lys-Cys-Gly-Met-Cys-Cys-Lys-Thr (Disulfide bridge:Cys7-Cys23; Cys10-Cys13; Cys11-Cys19; Cys14-Cys22) Sequence Shortening DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridge:Cys7-Cys23; Cys10-Cys13; Cys11-Cys19; Cys14-Cys22)