Product Name [Glu4]-Oxytocin acetate Biological activity -Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution. Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYIENCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage, away…
Product Name C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Biological activity C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal…
Product Name Orexin A (16-33) Biological activity Orexin A (16-33) is a fragment of orexin A. CAS Number 1374694-00-4 Sequence Sequence Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 Sequence Shortening Sequence Shortening LYELLHGAGNHAAGILTL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) Biological activity Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) (Human PTHrP (107-111) amide) is a C-terminal parathyroid hormone-related protein fragment that can inhibit bone resorption. CAS Number 155918-12-0 Sequence Sequence Thr-Arg-Ser-Ala-Trp-NH2 Sequence Shortening Sequence Shortening TRSAW-NH2 Storage Please store the…
Product Name GLP-1(7-36), amide Biological activity GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Molecular Weight 3297.68 Formula Formula C149H226N40O45 CAS Number 107444-51-9 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Product Name GIP (1-30) amide,human acetate Biological activity GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10-9-10-6 M. Formula Formula C164H244N40O49S Appearance Solid Color White to off-white…
Product Name Calcitonin (rat) Biological activity Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 11118-25-5…
Product Name β-Casomorphin, human Biological activity is an opioid peptide, acts as an agonist of opioid receptor. Molecular Weight 864 Formula Formula C44H61N7O11 CAS Number 102029-74-3 Sequence Sequence Tyr-Pro-Phe-Val-Glu-Pro-Ile Sequence Shortening Sequence Shortening YPFVEPI Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neurokinin B TFA Biological activity Neurokinin B TFA is a tachykinin family peptide that preferentially binds to and activates NK3R over other tachykinin receptors. Neurokinin B TFA preferentially binds to the substance P receptor (SP-N receptor) and mediates acetylcholine release from cholinergic neurons. Neurokinin B TFA regulates the pulsatile release of Kisspeptin and…
Product Name Oxyntomodulin (human, mouse, rat) Biological activity Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids. CAS Number 159002-68-3 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala Sequence Shortening Sequence…
Product Name Glucagon-like peptide 1 (1-37), human Biological activity Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor. Molecular Weight 4169.48 Formula Formula C186H275N51O59 CAS Number 87805-34-3 Appearance Solid Color White to off-white Sequence Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Product Name Ac-[Nle4,D-Phe7]-α-MSH (4-10)-NH2 Biological activity Ac–α-MSH (4-10)-NH2 is a melanotropin, a melanocyte-stimulating hormone. Ac–α-MSH (4-10)-NH2 stimulates tyrosinase and exhibits thermoregulatory effect in rats model. Molecular Weight 985.1 Formula Formula C47H64N14O10 CAS Number 82188-67-8 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening Ac-{Nle}-EH-{d-Phe}-RWG-NH2 Storage Sealed storage, away from moisture and light Powder -80??C…
Product Name GeX-2 Biological activity GeX-2 is a truncated analogue of αO-conotoxin. GeX-2 activates GABAB receptor. GeX-2 inhibits α9α10 nAChR and CaV2.2 channels. GeX-2 alleviates pain in the rat model of chronic constriction injury. CAS Number 2900996-95-2 Sequence Sequence Gly-Arg-Tyr-Arg-Ser-Pro-Tyr-Asp-Arg-Arg-Arg-Arg-Tyr-Arg-Arg-Ile-Thr-Asp-NH2 Sequence Shortening Sequence Shortening GRYRSPYDRRRRYRRITD-NH2 Storage Please store the product under the recommended conditions in…
Product Name Acetyl angiotensinogen (1-14), human Biological activity Acetyl angiotensinogen (1-14), human is a synthetic peptide and N-terminal acetylated form of Angiotensinogen (1-14), human (HY-P1486). CAS Number 104180-27-0 Sequence Sequence Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn Sequence Shortening Sequence Shortening Ac-DRVYIHPFHLVIHN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Galanin (1-19), human Biological activity Galanin (1-19), human is the 1-19 fragment of the human galanin. Galanin (GAL) is a widely distributed neuropeptide with diverse biological effects including modulation of hormone release, antinociception and modification of feeding behavior. CAS Number 136005-51-1 Appearance Solid Color White to off-white Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His Sequence Shortening Sequence…
Product Name (TYR34)-PTH (7-34) AMIDE (BOVINE) Biological activity (TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH). CAS Number 86292-93-5 Sequence Sequence Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 Sequence Shortening Sequence Shortening FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
