Insert HTML here
Showing 641–656 of 883 results
Product Name Echinotocin Biological activity Echinotocin is a neuropeptide found in sea urchins that has muscle contractile activity. Echinotocin can cause contractions of the tube feet and esophagus of sea urchins. Echinotocin can be used to study the role of neuropeptides in invertebrate physiology and behavior. CAS Number 1219926-10-9 Sequence Sequence Cys-Phe-Ile-Ser-Asn-Cys-Pro-Lys-Gly-NH2 Sequence Shortening Sequence…
Product Name NocII TFA Biological activity NocII TFA is an orphan neuropeptide which stimulates locomotion in mice. Formula Formula C92H141N23O28S2.xC2HF3O2 Sequence Sequence Phe-Ser-Glu-Phe-Met-Arg-Gln-Tyr-Leu-Val-Leu-Ser-Met-Gln-Ser-Ser-Gln Sequence Shortening Sequence Shortening FSEFMRQYLVLSMQSSQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name NTR 368 Biological activity NTR 368 is a peptide derived from p75 neurotrophin receptor (p75NTR) corresponding to residues 368-381 of the human receptor. NTR 368 has helix forming propensity in the presence of micellar lipid. NTR 368 is a potent inducer of neural apoptosis. CAS Number 197230-90-3 Sequence Shortening Sequence Shortening Ac-ATLDALLAALRRIQ-NH2 Storage…
Product Name Tyr0-Neurokinin B Biological activity Tyr0-Neurokinin B (Tyr-NKB) is an analogue of Neurokinin B. Tyr0-Neurokinin B can exerts contractions in bladder. CAS Number 131019-53-9 Sequence Sequence Tyr-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening YDMHDFFVGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Nocistatin(human) TFA Biological activity Nocistatin (human) TFA blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2. Formula Formula C149H238N42O53S3.C2HF3O2 Sequence Sequence Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln Sequence Shortening Sequence Shortening MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name NocII Biological activity NocII is an orphan neuropeptide which stimulates locomotion in mice. Formula Formula C92H141N23O28S2 CAS Number 188119-47-3 Sequence Sequence Phe-Ser-Glu-Phe-Met-Arg-Gln-Tyr-Leu-Val-Leu-Ser-Met-Gln-Ser-Ser-Gln Sequence Shortening Sequence Shortening FSEFMRQYLVLSMQSSQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name NTR 368 TFA Biological activity NTR 368 TFA is a peptide derived from p75 neurotrophin receptor (p75NTR) corresponding to residues 368-381 of the human receptor. NTR 368 TFA has helix forming propensity in the presence of micellar lipid. NTR 368 TFA is a potent inducer of neural apoptosis. Sequence Shortening Sequence Shortening Ac-ATLDALLAALRRIQ-NH2…
Product Name Oxyntomodulin (bovine, porcine) TFA Biological activity Oxyntomodulin (bovine, porcine) TFA, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist. Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide W-23 (human) TFA Biological activity Neuropeptide W-23 (human) (NPW-23) TFA, the active form of Neuropeptide W, is an endogenous agonist of NPBW1 (GPR7) and NPBW2 (GPR8). Molecular Weight 2698.03 Formula Formula C119H183N35O28S.C2HF3O2 Sequence Sequence Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-LeuMet-Gly-Leu Sequence Shortening Sequence Shortening WYKHVASPRYHTVGRAAGLLMGL Storage Please store the product under the recommended conditions in the Certificate…
Product Name Xenopus orexin A Biological activity Xenopus orexin A is a neuropeptides that identified as an endogenous ligands for an orphan G-protein-coupled receptor. Xenopus orexin A is a potent agonist of OX1R. CAS Number 254757-77-2 Sequence Sequence Ala-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Ile-Tyr-Asp-Ile-Leu-Arg-Gly-Thr-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 (Disulfide bridge:Cys4-Cys10;Cys5-Cys12) Sequence Shortening Sequence Shortening APDCCRQKTCSCRIYDILRGTGNHAAGILTL-NH2 (Disulfide bridge:Cys4-Cys10;Cys5-Cys12) Storage Please store the product under the…
Product Name (Gly14)-Humanin (human) Biological activity (Gly14)-Humanin (human) (14-Glycine-Humanin (human)) is an analog of Humanin in which the 14th amino acid serine was replaced with glycine (Gly). (Gly14)-Humanin (human) has anti-apoptotic and neuroprotective functions. Molecular Weight 2657.21 Formula Formula C118H202N34O31S2 CAS Number 330936-70-4 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening MAPRGFSCLLLLTGEIDLPVKRRA Storage…
Product Name Urocortin, rat TFA Biological activity Urocortin, rat TFA (Urocortin (Rattus norvegicus) TFA) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively. Molecular Weight 4821.28 Formula Formula C208H339N62F3O66 Sequence Shortening Sequence Shortening DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 Storage Please…
Product Name Obestatin(rat) TFA Biological activity Obestatin(rat) TFA, encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) TFA suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) TFA has anti-inflammatory, anti-myocardial infarction and antioxidant activities. CAS Number…
Product Name Galanin (1-29)(rat, mouse) Biological activity Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect. CAS Number 114547-31-8 Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 Sequence Shortening Sequence Shortening GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Storage Please store the product under the recommended conditions in the Certificate…
Product Name Nesfatin-1 (24-53), mouse/rat Biological activity Nesfatin-1 (24-53), mouse/rat is a peptide. Nesfatin-1 (24-53), mouse/rat significantly decreases food intake, inhibits gastroduodenal motility. Sequence Sequence Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2 Sequence Shortening Sequence Shortening PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Orexin A (human, rat, mouse) Biological activity Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us