Lysipressin acetate

Description

Product Name	Prolactin Releasing Peptide (1-31), human acetate
Biological activity	Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis.
Molecular Weight	3724.17
Formula	Formula C162H26N56O44S
Appearance	Solid
Color	Light yellow to yellow
Sequence	Sequence Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Sequence Shortening	Sequence Shortening SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Storage	Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture and light, under nitrogen)