Neuropeptides

Product Name Helodormin Biological activity Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families. CAS…

Product Name Stresscopin (human) Biological activity Stresscopin (human) is a selective ligand of type 2 adrenocorticotropin-releasing hormone (CRH) receptors and can be used in the research of stress-related diseases. CAS Number 352020-03-2 Sequence Sequence Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 Sequence Shortening Sequence Shortening TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name [Pro3]-GIP (Rat) Biological activity -GIP (Rat) is a selective GIP receptor partial agonist with a Ki of 13 nM. -GIP (Rat) can be used in diabetes research. Sequence Sequence Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln Sequence Shortening Sequence Shortening YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Allatostatin C Biological activity Allatostatin C (AstC) is a neuropeptide that suppresses gonadotropin production. Allatostatin C generates oogenesis rhythm by regulating juvenile hormone and vitellogenesis indirectly via insulin signaling. Allatostatin C can be used for neurological research. CAS Number 1412455-91-4 Sequence Sequence {pGlu}-Val-Arg-Tyr-Arg-Gln-Cys-Tyr-Phe-Asn-Pro-Ile-Ser-Cys-Phe (Disulfide bridge: Cys6-Cys13) Sequence Shortening Sequence Shortening {pGlu}-VRYRQCYFNPISCF (Disulfide bridge:…

Product Name (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Biological activity (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field…

Product Name [D-Lys6]-LH-RH Biological activity -LH-RH is a Luteinizing-hormone-releasing hormone (LHRH) analogue. -LH-RH acts as a GnRH receptor agonist. Molecular Weight 1253.41 Formula Formula C59H84N18O13 CAS Number 52671-12-2 Appearance Solid Color White to off-white Sequence Sequence {Glp}-His-Trp-Ser-Tyr-{d-Lys}-Leu-Arg-Pro-Gly-NH2 Sequence Shortening Sequence Shortening {Glp}-HWSY-{d-Lys}-LRPG-NH2

Product Name Urocortin III, mouse Biological activity Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics. CAS Number 357952-10-4 Appearance Solid Color White…

Product Name Calcitonin (chicken) Biological activity Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts. CAS Number 100016-62-4 Sequence Sequence Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7) Storage Please store the product under the recommended conditions in…