Product Name [Ala2,8,9,11,19,22,24,25,27,28]-VIP Biological activity -VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter. CAS Number 866552-34-3 Sequence Sequence His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-NH2 Sequence Shortening Sequence Shortening HADAVFTAAYARLRKQMAAKKALAAIAA-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name Amylin, amide, rat Biological activity Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Molecular Weight 3920.44 Formula Formula C167H272N52O53S2 CAS Number 124447-81-0 Appearance Solid Color White to off-white Sequence Sequence…
Product Name Leucokinin VIII Biological activity Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach. Formula Formula C42H52N10O11 CAS Number 2703746-05-6 Sequence Sequence Gly-Ala-Ser-Phe-Tyr-Ser-Trp-Gly-NH2 Sequence Shortening Sequence Shortening GASFYSWG-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide Y (13-36), amide, human Biological activity Neuropeptide Y (13-36), amide, human is a selective?neuropeptide Y2 receptor?agonist. Molecular Weight 3000.4 Formula Formula C134H207N41O36S CAS Number 122341-40-6 Appearance Solid Color White to off-white Sequence Sequence Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening PAEDMARYYSALRHYINLITRQRY-NH2
Product Name Gastrin I (1-14), human Biological activity Gastrin I (1-14), human is 1-14 fragment of human gastrin I peptide. Gastrin I is an endogenous, gastrointestinal peptide hormone. Gastrin is the major hormonal regulator of gastric acid secretion. CAS Number 100940-57-6 Appearance Solid Color White to off-white Sequence Sequence {Glp}-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp Sequence Shortening Sequence Shortening {Glp}-GPWLEEEEEAYGW…
Product Name Eledoisin Related Peptide Biological activity Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand. Molecular Weight 706.94 Formula Formula C34H58N8O6S CAS Number 2990-43-4 Appearance Solid Color White to off-white Sequence Sequence Lys-Phe-Ile-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening KFIGLM-NH2
Product Name Substance P(1-7) Biological activity Substance P(1-7) is a fragment of the neuropeptide, substance P (SP). Substance P(1-7) gives depressor and bradycardic effects when applied to the nucleus tractus solitarius. Formula Formula C41H65N13O10 CAS Number 68060-49-1 Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe Sequence Shortening Sequence Shortening RPKPQQF Storage Please store the product under the recommended conditions in…
Product Name Bradykinin (1-7) Biological activity Bradykinin (1-7) is an amino-truncated Bradykinin peptide. Bradykinin (1-7) is a metabolite of Bradykinin, cleaved by endopeptidase. Formula Formula C35H52N10O9 CAS Number 23815-87-4 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Pro-Gly-Phe-Ser-Pro Sequence Shortening Sequence Shortening RPPGFSP Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1…
Product Name APGW-amide Biological activity APGW-amide is a neuropeptide. APGW-amide controls the growth of imposex structures and promotes growth in Haliotis asinina. APGW-amide inhibits Achatina neurons and modulates neuronal currents induced by neuroactive compounds. APGW-amide induces a rapid increase in i in Fura-2/AM-loaded PC12 cells. APGW-amide is useful for research on the nervous system. Molecular…
Product Name Pancreatic Polypeptide, rat Biological activity Pancreatic Polypeptide, rat (Rat pancreatic polypeptide) is a rat-derived Pancreatic Polypeptide. Pancreatic Polypeptide is a preferential agonist of NPYR4. Pancreatic Polypeptide, rat protects cells against Streptozotocin (HY-13753)-induced DNA damage. Pancreatic Polypeptide, rat inhibits glucose-stimulated insulin secretion. Pancreatic Polypeptide, rat (TFA) can be used in diabetes-related research. Molecular Weight…
Product Name Locustatachykinin I Biological activity Locustatachykinin I is a insect tachykinin-related peptide isolated from Locusta migratoria. Locustatachykinin I exhibits sequence homologies with the vertebrate tachykinins. In Lacanobia, Locustatachykinin I is also a substrate for a deamidase. CAS Number 126985-97-5 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening GPSGFYGVR-NH2 Storage Sealed storage, away…
Product Name GLP-1(28-36)amide Biological activity GLP-1(28-36)amide, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP). GLP-1(28-36)amide is an antioxidant and targets to mitochondrion, inhibits mitochondrial permeability transition (MPT). GLP-1(28-36)amide has anti-diabetic and cardioprotection effects. Molecular Weight 1088.35 Formula Formula C54H85N15O9 CAS Number 1225021-13-5 Appearance…
Product Name Mini Gastrin I, human Biological activity Mini Gastrin I, human is a shorter version of human gastrin, consists of amino acids 5-17 of the parent peptide. Formula Formula C74H99N15O26S CAS Number 54405-27-5 Sequence Sequence Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening LEEEEEAYGWMDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name Angiotensin II (1-4), human TFA Biological activity Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca2+ levels. Angiotensin II also acts at the Na+/H+ exchanger…
Product Name [Dmt1]DALDA Biological activity DALDA is a potent and long-acting analgesic binds to the mu opioid receptor with high affinity and selectivity. DALDA is a full agonist at hMOR (Kd = 0.199 nM) and hDOR, but only partial agonist against hKOR. CAS Number 255861-98-4 Sequence Sequence {Dmt}-{d-Arg}-Phe-Lys-NH2 Sequence Shortening Sequence Shortening {Dmt}-{d-Arg}-FK-NH2 Storage Please…
Product Name GLP-1(32-36)amide TFA Biological activity GLP-1(32-36)amide TFA, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide TFA could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice. Molecular Weight 684.75 Formula Formula C27H51F3N10O7 Sequence Sequence Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening LVKGR-NH2 Storage Please store the product under…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
