Neuropeptides

Product Name Pancreatic Polypeptide, human Biological activity Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Molecular Weight 4181.71 Formula Formula C185H287N53O54S2 CAS Number 75976-10-2 Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Product Name Allatostatin IV Biological activity Allatostatin IV is an octapeptide. Allatostatins are pleiotropic neuropeptides for inhibition of juvenile hormone synthesis in insects. CAS Number 123338-13-6 Sequence Sequence Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2 Sequence Shortening Sequence Shortening DRLYSFGL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Adrenocorticotropic Hormone (ACTH) (4-10), human Biological activity Adrenocorticotropic Hormone (ACTH) (4-10), human is a melanocortin 4 (MC4R) receptor agonist. Molecular Weight 962.09 Formula Formula C44H59N13O10S CAS Number 780533 Appearance Solid Color White to off-white Sequence Sequence Met-Glu-His-Phe-Arg-Trp-Gly Sequence Shortening Sequence Shortening MEHFRWG

Product Name γ3-MSH Biological activity γ3-MSH is derived from the N-terminal segment of pro-opiomelanocortin (POMC). γ3-MSH stimulates aldosterone secretion by human adrenal tumor cells in culture. CAS Number 72629-64-2 Sequence Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln Sequence Shortening Sequence Shortening YVMGHFRWDRFGRRNGSSSSGVGGAAQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name TLQP-30 Biological activity TLQP-30 is a VGF peptide. CAS Number 922704-13-0 Sequence Shortening Sequence Shortening TLQPPASSRRRHFHHALPPARHHPDLEAQA Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Parathyroid Hormone (1-34), bovine Biological activity Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis. Molecular Weight 4108.77 Formula Formula C183H288N54O50S2 CAS Number 12583-68-5 Appearance Solid…

Product Name Sulfated sulfakinin Biological activity Sulfated sulfakinin is a Sulfakinin receptor (SKR) activator with EC50s of 1.6 and 5.4 nM for Tribolium castaneumTc TcSKR1 and TcSKR2, respectively. SKRs are G-protein-coupled receptors (GPCRs) that interact with sulfakinins to modulate diverse biological processes. Sulfated sulfakinin can be used for tho control of pest insects research. CAS…

Product Name Angiotensin II (1-4), human Biological activity Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca2+ levels. Angiotensin II also acts at the Na+/H+ exchanger in the…