Product Name Atriopeptin II (rat, mouse) Biological activity Atriopeptin II rat, mouse is an atrial natriuretic peptide, which acts as diuretic and natriuretic agent, and a potent relaxant of vascular smooth muscle. Formula Formula C98H156N34O32S2 CAS Number 89139-54-8 Sequence Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge: Cys3-Cys19) Sequence Shortening Sequence Shortening SSCFGGRIDRIGAQSGLGCNSFR (Disulfide bridge: Cys3-Cys19) Storage Please store…
Product Name biotin-Bradykinin Biological activity biotin-Bradykinin is a biological active peptide. (Biotin labeled HY-P0206) CAS Number 477319-71-4 Appearance Solid Color White to off-white Sequence Sequence {Biotin-Arg}-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg Sequence Shortening Sequence Shortening {Biotin-Arg}-PPGFSPFR Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage,…
Product Name Lys-Conopressin-G Biological activity Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis). CAS Number 111317-91-0 Sequence Sequence Cys-Phe-Ile-Arg-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys1-Cys6) Sequence Shortening Sequence Shortening CFIRNCPKG-NH2 (Disulfide bridge: Cys1-Cys6) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Prolactin-Releasing Peptide (1-31), bovine Biological activity Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP). Sequence Shortening Sequence Shortening SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name D-JBD19 TFA Biological activity D-JBD19 TFA is a non-permeable peptide. D-JBD19 TFA has neuroprotective effects. Molecular Weight 2364.58 Formula Formula C101H165F3N32O30 Sequence Shortening Sequence Shortening DQSRPVQPFLNLTTPRKPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Somatostatin-28 (1-14) Biological activity Somatostatin-28 (1-14) is an N-terminal fragment of the neuropeptide somatostatin-28. Formula Formula C61H105N23O21S CAS Number 79243-10-0 Appearance Solid Color White to off-white Sequence Sequence Ser-Ala-Asn-Ser-Asn-Pro-Ala-Met-Ala-Pro-Arg-Glu-Arg-Lys Sequence Shortening Sequence Shortening SANSNPAMAPRERK Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name Neuropeptide EI, rat Biological activity Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms. CAS Number 125934-45-4 Sequence Sequence Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-NH2 Sequence Shortening Sequence Shortening EIGDEENSAKFPI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Tyr11]-Somatostatin Biological activity -Somatostatin is a neuroavtive peptide for proteomics research. Somatostatin is one of many neuroactive substances that influence retinal physiology. Formula Formula C76H104N18O20S2 CAS Number 59481-27-5 Appearance Solid Color White to off-white Sequence Sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Tyr-Thr-Ser-Cys (Disulfide bridge:Cys3-Cys14) Sequence Shortening Sequence Shortening AGCKNFFWKTYTSC (Disulfide bridge:Cys3-Cys14) Storage Sealed storage, away from moisture Powder…
Product Name Calcitonin (human) Biological activity Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research. Molecular Weight 3417.87 Formula Formula C151H226N40O45S3 CAS Number 21215-62-3 Appearance Solid Color White to off-white Sequence Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7) Sequence Shortening Sequence Shortening…
Product Name Luteinizing hormone (human) Biological activity Luteinizing hormone (human), a heterodimeric glycoprotein hormone produced by the pituitary gland (LH), plays key roles in human reproduction. CAS Number 39341-83-8 Appearance Solid Color White to off-white Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Calcitonin (salmon) Biological activity Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption. Molecular Weight 3431.85 Formula Formula C145H240N44O48S2 CAS Number 47931-85-1 Appearance Solid Color White to off-white Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide…
Product Name C-Terminally encoded peptide 1 Biological activity C-Terminally encoded peptide 1 (CEP1) is a small secreted peptide hormone. C-Terminally encoded peptide 1 is involved in regulating plant growth and abiotic stresses through cellular communication. C-Terminally encoded peptide 1 can be used in the study of plant growth and development. Appearance Solid Color White to…
Product Name Adrenocorticotropic Hormone (ACTH) (1-10), human Biological activity Adrenocorticotropic Hormone (ACTH) (1-10), human, an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM). Formula Formula C59H78N16O16S CAS Number 325553 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly Sequence Shortening Sequence Shortening SYSMEHFRWG Storage…
Product Name Proadrenomedullin (45-92), human Biological activity Proadrenomedullin (45-92), human is a peptide corresponding to amino acids 45-92 of human preproadrenomedullin. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products. Formula Formula C215H359N67O73S2 CAS…
Product Name Galanin message associated peptide (1-41) amide Biological activity Galanin message associated peptide (1-41) amide is a peptide hormone. CAS Number 132699-74-2 Sequence Sequence Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2 Sequence Shortening Sequence Shortening ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Human PTHrP-(1-36) Biological activity Human PTHrP-(1-36) is a secretory form of PTHrP with anticalciuric effects. Human PTHrP-(1-36) enhances beta cell function and proliferation. Human PTHrP-(1-36) can be used in the research of humoral hypercalcemia of malignancy (HHM) and hyperparathyroidism. Human PTHrP-(1-36) sequence is highly conserved and can be used for experiments in humans,…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
