Neuropeptides

Product Name ACTH (1-16) (human) Biological activity ACTH (1-16) (human) (Adrenocorticotropic hormone (1-16)) is an ACTH fragment. ACTH (1-16) (human) improves cardiovascular function and survival in experimental hemorrhagic shock. CAS Number 5576-42-1 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKK Storage Sealed storage, away from moisture Powder -80??C 2…

Product Name N-Acetyl-α-Endorphin Biological activity N-Acetyl-α-Endorphin is an acetylated α-Endorphin at N-terminal. α-Endorphin is an endogenous opioid peptide. CAS Number 88264-63-5 Sequence Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr Sequence Shortening Sequence Shortening Ac-YGGFMTSEKSQTPLVT Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Caerulein, desulfated Biological activity Caerulein, desulfated is the desulfurated form of Caerulein. Caerulein is a decapeptide having the same five carboxyl-terminal amino acids as gastrin and cholecystokinin (CCK). CAS Number 20994-83-6 Sequence Sequence {Glp}-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Glp}-QDYTGWMDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name β-Casomorphin, bovine TFA Biological activity β-Casomorphin, bovine TFA (β-Casomorphin-7 (bovine) TFA) is a opioid peptide with an IC50 of 14 ??M in an Opioid receptors binding assay. Molecular Weight 903.94 Formula Formula C43H56F3N7O11 Sequence Sequence Tyr-Pro-Phe-Pro-Gly-Pro-Ile Sequence Shortening Sequence Shortening YPFPGPI Storage Please store the product under the recommended conditions in the Certificate…

Product Name Acetyl angiotensinogen (1-14), porcine Biological activity Acetyl angiotensinogen (1-14), porcine is a synthetic peptide and N-terminal acetylated form of Angiotensinogen (1-14) porcine (HY-P4774). CAS Number 66641-26-7 Sequence Sequence Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser Sequence Shortening Sequence Shortening Ac-DRVYIHPFHLLVYS Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Peptide YY (PYY) (3-36), porcine TFA Biological activity Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. Appearance Solid Color White to off-white Sequence Sequence Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr Sequence Shortening Sequence Shortening AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years…

Product Name Galanin (2-29) (rat) Biological activity Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM). CAS Number 141696-11-9 Sequence Sequence Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 Sequence Shortening Sequence Shortening WTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Substance P(1-7) TFA Biological activity Substance P(1-7) TFA is a fragment of the neuropeptide, substance P (SP). Substance P(1-7) TFA gives depressor and bradycardic effects when applied to the nucleus tractus solitarius. Formula Formula C43H66F3N13O12 CAS Number 2828433-22-1 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe Sequence Shortening Sequence Shortening RPKPQQF Storage…