Neuropeptides

Product Name γ-1-Melanocyte Stimulating Hormone (MSH), amide Biological activity γ-1-Melanocyte Stimulating Hormone (MSH), amide is a 11-amino acid peptide. γ-1-Melanocyte Stimulating Hormone (MSH) regulates sodium (Na+) balance and blood pressure through activation of the melanocortin receptor 3 (MC3-R). Molecular Weight 1512.9 Formula Formula C72H97N21O14S CAS Number 72629-65-3 Appearance Solid Color White to light yellow Sequence…

Product Name Biotinyl-BNP-32 (human) Biological activity Biotinyl-BNP-32 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1816258-27-1…

Product Name Goserelin Biological activity Goserelin (ICI 118630), a decapeptide analogue of gonadotropin-releasing hormone (GnRH/LHRH), functions as a GnRH agonist. Goserelin can be used for the research of breast cancer, epithelial ovarian cancer and prostate cancer. Molecular Weight 1269.41 Formula Formula C59H84N18O14 CAS Number 65807-02-5 Sequence Sequence {Glp}-His-Trp-Ser-Tyr-Ser(OtBu)-Leu-Arg-Pro-{Hydrazinecarboxamide} Sequence Shortening Sequence Shortening {Glp}-HWSY-Ser(OtBu)-LRP-{Hydrazinecarboxamide}

Product Name Xenin Biological activity Xenin is a 25-amino acid peptide initially isolated from human gastric mucosa. Xenin is a gut hormone that can reduce food intake. Molecular Weight 2971.57 Formula Formula C139H224N38O32S CAS Number 144092-28-4 Appearance Solid Color White to off-white Sequence Sequence Met-Leu-Thr-Lys-Phe-Glu-Thr-Lys-Ser-Ala-Arg-Val-Lys-Gly-Leu-Ser-Phe-His-Pro-Lys-Arg-Pro-Trp-Ile-Leu Sequence Shortening Sequence Shortening MLTKFETKSARVKGLSFHPKRPWIL

Product Name sGnRH-A acetate Biological activity sGnRH-A acetate is a salmon gonadotropin-releasing hormone (GnRH) analogue. sGnRH-A acetate stimulates growth hormone secretion. sGnRH-A acetate also can be used as an inducer of ovulation by artificial insemination. Formula Formula C64H83N17O12??xC2H4O2 Appearance Solid Color White to off-white Sequence Sequence {pGlu}-His-Trp-Ser-Tyr-{d-Arg}-Trp-Leu-Pro-NHEt Sequence Shortening Sequence Shortening {pGlu}-HWSY-{d-Arg}-WLP-NHEt Storage Sealed storage,…

Product Name GHRF, mouse Biological activity GHRF, mouse, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse stimulates the release and synthesis of growth hormone. Formula Formula C220H365N69O64S CAS Number 125199-49-7 Sequence Sequence His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser Sequence Shortening Sequence Shortening HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS Storage Please store the product under the recommended conditions in the…

Product Name Auriculin B Biological activity Auriculin B (ANP (126-150) (Rat)) is a rat-derived atrial natriuretic peptide. Auriculin B has potent vasodilatory and diuretic properties. CAS Number 90052-57-6 Sequence Shortening Sequence Shortening RSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge:Cys4-Cys20) Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name GIP (22-51) human Biological activity GIP (22-51) human (Glucose-dependent Insulinotropic Peptide (22-51) human) is a potent proatherosclerotic peptide hormone consisting of 30 amino acids. GIP (22-51) human can activate the NF-??B signaling pathway, promote the expression of MMP-8, and induce the expression of proinflammatory and proatherosclerotic proteins. GIP (22-51) human can also increase…