Product Name β-Endorphin, rat Biological activity β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats. CAS Number 59887-17-1 Sequence Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln Sequence Shortening Sequence Shortening YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ Storage Please store the product under the recommended conditions in the…
Product Name [Mpr7, DAla9] ANP (7-28), amide, rat Biological activity ANP (7-28), amide, rat is an atrial peptide. CAS Number 112926-01-9 Sequence Shortening Sequence Shortening {Mpr}-FAGRIDRIGAQSGLGCNSFRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Tyr8]-Atrial Natriuretic Peptide (5-27), rat Biological activity -Atrial Natriuretic Peptide (5-27), rat is an atrial natriuretic peptide (ANP) analog that relaxes smooth muscle without affecting cGMP levels. Formula Formula C98H158N34O33S2 CAS Number 108703-67-9 Sequence Shortening Sequence Shortening SSCYGGRIDRIGAQSGLGCNSFR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name RI-61 Biological activity RI-61 is a compound that has activity in suppressing migraine, cluster headache, new daily persistent headache and cyclical vomiting syndrome. RI-61 has shown significant efficacy in relieving the symptoms of these disorders. RI-61 helps relieve pain and other related symptoms by modulating the action of neurotransmitters. CAS Number 95034-26-7 Sequence…
Product Name Atriopeptin I (rat, mouse) Biological activity Atriopeptin I rat, mouse is an atrial natriuretic peptide, which stimulates the testosterone production with half-maximum stimulation of 38 nM. CAS Number 89139-53-7 Sequence Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser (Disulfide bridge: Cys3-Cys19) Sequence Shortening Sequence Shortening SSCFGGRIDRIGAQSGLGCNS (Disulfide bridge: Cys3-Cys19) Storage Please store the product under the recommended conditions in…
Product Name Agalactoglyco peptide Biological activity Agalactoglyco peptide is an peptide. Agalactoglyco peptide can be used for the research of various biochemical. CAS Number 361443-82-5 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Atriopeptin III (rat) Biological activity Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure. CAS Number 90817-13-3…
Product Name BNP (1-21), Pro (Human) Biological activity BNP (1-21), Pro (Human) is a peptide containg 21 amino acids. B-Type Natriuretic Peptide (BNP), a cardiac natriuretic hormone. BNP together with the highly homologous atrial natriuretic peptide, it forms a dual natriuretic peptide system of the heart. BNP is responsible for changes in the heart organogenesis…
Product Name FC382K10W15 TFA Biological activity FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research. Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-Ser-Lys-Tyr-Leu-Asp-Ser-Gln-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser Sequence Shortening Sequence Shortening HSQGTFTSD-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-SKYLDSQAAQDFVQWLMNGGPSSGAPP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Phe7)-Somatostatin-14 Biological activity (D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 64813-74-7 Sequence Sequence…
Product Name (Ser8)-GLP-1 (7-36) amide, human Biological activity (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion. CAS Number…
Product Name GIP, rat Biological activity GIP, rat is a bioactive peptide derived from rats. GIP, rat inhibits GIP-mediated postprandial insulin release as well as GIP-promoted glucose uptake in the upper small intestine. GIP, rat can be used in research related to insulin resistance, glucose intolerance, and type 2 diabetes. Molecular Weight 5002.58 Formula Formula…
Product Name CCK (27-33) Biological activity CCK (27-33) is the C-terminal heptapeptide of cholecystokinin (CCK). CAS Number 47910-79-2 Sequence Shortening Sequence Shortening YMGWMDF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Secretin, canine TFA Biological activity ecretin, canine TFA is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine TFA can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway. Appearance Solid Color White to off-white Sequence Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 Sequence Shortening Sequence…
Product Name Thymocartin TFA Biological activity Thymocartin TFA is the TFA salt form of Thymocartin (HY-105025). Thymocartin TFA inhibits apoptosis of peripheral blood lymphocytes in HIV infected individuals. Thymocartin TFA is potential for immunodeficiency diseases research. Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year…
Product Name SALMF amide 2 Biological activity SALMF amide 2, a neuropeptide S2 from the starfish Asterias rubens, is involved in the regulation of eversion of the cardiac stomach in starfish. Formula Formula C59H82N14O18 CAS Number 134439-74-0 Sequence Shortening Sequence Shortening SGPYSFNSGLTF-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
