Neuropeptides

Product Name [Tyr8]-Substance P Biological activity -Substance P is an active peptide. -Substance P can be used for the research of various biochemical. Molecular Weight 1363.63 Formula Formula C63H98N18O14S CAS Number 55614-10-3 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening RPKPQQFYGLM-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1…

Product Name [D-Val22, Phe33] Big Endothelin-1 (16-38), human Biological activity Big Endothelin-1 (16-38), human is a polypeptide. CAS Number 1206769-73-4 Sequence Sequence His-Leu-Asp-Ile-Ile-Trp-{d-Val}-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Phe-Gly-Ser-Pro-Arg-Ser Sequence Shortening Sequence Shortening HLDIIW-{d-Val}-NTPEHVVPYGFGSPRS Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Adipokinetic hormone I (Locusta migratoria) Biological activity Adipokinetic hormone I (Locusta migratoria) (Lom-AKH-I) is a insect adipokinetic hormone (AKH), enhances fat body cAMP levels in vitro. Insect adipokinetic hormones (AKHs) controls flight-directed mobilization of carbohydrate and lipid from fat body stores, which depends on AKH receptor(s) coupling to cAMP formation and glycogen phosphorylase…

Product Name Adrenomedullin (AM) (1-52), human TFA Biological activity Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer. Formula Formula C264H406N80O77S3.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) Sequence Shortening Sequence Shortening YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21) Storage Sealed storage, away from moisture and light Powder -80??C 2…

Product Name Carperitide Biological activity Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way. Molecular Weight 3080.44 Formula…

Product Name GLP-1(7-37) acetate Biological activity GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Formula Formula C151H228N40O47.xC2H4O2 CAS Number 1450806-98-0 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In…

Product Name Caerulein, desulfated TFA Biological activity Caerulein, desulfated TFA is the desulfurated form of Caerulein. Caerulein is a decapeptide having the same five carboxyl-terminal amino acids as gastrin and cholecystokinin (CCK). Appearance Solid Color White to off-white Sequence Sequence {Glp}-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Glp}-QDYTGWMDF-NH2 Storage Sealed storage, away from moisture Powder -80??C 2…

Product Name Substance P (1-9) Biological activity Substance P (1-9) is nonapeptide, which decreases the inactivation of substance P by the guinea-pig ileum and urinary bladder. Formula Formula C52H77N15O12 CAS Number 57468-17-4 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly Sequence Shortening Sequence Shortening RPKPQQFFG Storage Sealed storage, away from moisture and light, under…