Antimicrobial Peptides

LL-37-Cys is LL-37 (HY-P1222) carrying a reduced cysteine residue at the C-terminus. Product Details Product Name LL-37-Cys Biological activity LL-37-Cys is a LL-37 (HY-P1222) with a C-terminal reduced cystein residue[. Sequence Shortening LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC Storage Please store the product under the recommended conditions in the Certificate of Analysis.

LL-37, acetylated, amidated is an N-terminally acetylated, C-terminally amidated cathelicidin peptide LL-37. Human cathelicidin peptide LL-37 has antibacterial and anti-biofilm activity against a variety of Gram-positive and Gram-negative human pathogens and exerts wound-healing effects on the host. Product Details Product Name LL-37, acetylated,amidated Biological activity LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on…

LL-37, human TFA is an amphipathic, cathelicidin-derived antimicrobial peptide with 37 residues, exhibiting broad-spectrum antibacterial activity. LL-37, human TFA helps protect the cornea from infection and regulates wound healing. Product Details Product Name LL-37, human TFA Biological activity LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial…

LL-37 (17-32) is an ABCG2 inhibitor. LL-37 (17-32) binds to ABCG2, inhibits its transport activity in a non-competitive manner, and downregulates ABCG2 protein expression through lysosomal degradation. LL-37 (17-32) increases the accumulation of mitoxantrone (HY-13502) in ABCG2-overexpressing cancer cells, thereby reversing mitoxantrone resistance. LL-37 (17-32) can be used in research on multidrug-resistant cancers. Product Details…

LS-BF1 is a stable, low-toxicity cationic antimicrobial peptide. LS-BF1 shows broad-spectrum antibacterial activity through a cell membrane disruption mechanism, including against challenging ESKAPE pathogens. LS-BF1 shows good in vivo bacterial clearance in mouse infection models. Product Details Product Name LS-BF1 Biological activity LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad…

Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer, and anti-aging properties. Lunasin can be isolated from soybeans. Lunasin also has an epigenetic mechanism of action related to histone acetylation. Lunasin can be internalized into cells and inhibits the formation of oncospheres in cancer cells. Product Details Product Name Lunasin Biological activity Lunasin is a…

Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacteria, including MDR strains (MIC: 8-32 ??g/mL against methicillin-resistant MRSA strains). Lynronne-1 reduces bacterial load in a mouse model of MRSA-infected wounds. Lynronne-1 is also effective against P. aeruginosa infection. Product Details Product Name Lynronne-1 Biological activity Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active…

Lynronne-2 is an antimicrobial peptide. Lynronne-2 is active against Gram-positive bacteria, including MDR strains (MIC: 32-256 ??g/mL against methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection. Product Details Product Name Lynronne-2 Biological activity Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 32-256 ??g/mL for methicillin-resistant…