LL-37, human TFA
Description
LL-37, human TFA is an amphipathic, cathelicidin-derived antimicrobial peptide with 37 residues, exhibiting broad-spectrum antibacterial activity. LL-37, human TFA helps protect the cornea from infection and regulates wound healing.
Product Details
| Product Name | LL-37, human TFA |
| Biological activity | LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing. |
| Formula | C205H340N60O53.xC2HF3O2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | [LL-37, 37 aa] |
| Storage | Sealed storage, away from moisture |
