Antimicrobial Peptides

LF11 TFA is a peptide with antibacterial activity. Product Details Product Name LF11 TFA Biological activity LF11 TFA is a peptide with antibacterial activity. Sequence Shortening FQWQRNIRKVR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

LfcinB 17-28 TFA has weak antibacterial activity (MIC of 200 ??M against E. coli). LfcinB 17-28 TFA is a fragment of bovine lactoferricin (LfcinB). Product Details Product Name LfcinB 17?C28 TFA Biological activity LfcinB 17?C28 TFA has weak antimicrobial activity (MIC: 200 ??M against E. coli). LfcinB 17?C28 TFA is a fragment of Bovine Lactoferricin…

LL-37 (37-1) is the reverse sequence of LL-37 (HY-P1222), with biological activity highly similar to that of LL-37. LL-37 (37-1) has bactericidal function and is a host defense peptide of the immune system. LL-37 (37-1) can interact with double-stranded RNA (dsRNA) to inhibit double-stranded RNA-induced production of thymic stromal lymphopoietin, CCL5/RANTES, CXCL10/IP-10, and CXCL8/IL-8, and…

LL-37 amide is a selective agonist of the formyl peptide receptor-like FPRL1 and effectively inhibits periodontal pathogens (ED99=8.5-8.7 ??g/mL). LL-37 amide mediates immune cell chemotaxis through activation of FPRL1, while exerting bactericidal effects by disrupting bacterial cell membrane integrity. It also modulates inflammatory responses (inhibiting the release of factors such as TNF-??) and promotes angiogenesis;…

LL-37 FK-13 TFA is the TFA salt form of LL-37 FK-13 (HY-P4836). LL-37 FK-13 TFA is an antibacterial agent that inhibits Trichomonas vaginalis. LL-37 FK-13 TFA has weak hemolytic activity against human erythrocytes and weak cytotoxicity against human fibroblasts. Product Details Product Name LL-37 FK-13 TFA Biological activity LL-37 FK-13 TFA is the TFA salt…

LL-37 FKR is a C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial properties. Product Details Product Name LL-37 FKR Biological activity LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance. Sequence Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Sequence Shortening FKRIVQRIKDFLRNLVPRTES Storage Please store the product under the recommended…

LL-37 RKS is an active fragment of LL-37. Product Details Product Name LL-37 RKS Biological activity LL-37 RKS is an active fragment of LL-37. Sequence Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Sequence Shortening RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Storage Please store the product under the recommended conditions in the Certificate of Analysis.

LL-37 scrambled peptide is a scrambled rearrangement peptide of the cathelicidin antimicrobial peptide LL-37 and can be used as a negative control for LL-37 peptide research. Product Details Product Name LL-37 scrambled peptide Biological activity LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a…