Gramicidin B is a non-ribosomal peptide antibiotic. Product Details Product Name Gramicidin B Biological activity Gramicidin B is a nonribosomal peptide antibiotic. Sequence {formyl-Val}-Gly-Ala-{d-Leu}-Ala-{d-Val}-Val-{d-Val}-Trp-{d-Leu}-Phe-{d-Leu}-Trp-{d-Leu}-{Trp-ethanolamine} Sequence Shortening {formyl-Val}-GA-{d-Leu}-A-{d-Val}-V-{d-Val}-W-{d-Leu}-F-{d-Leu}-W-{d-Leu}-{Trp-ethanolamine} Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Gramicidin C is a natural polypeptide antibiotic that can be isolated from B. brevis var. G.B. Product Details Product Name Gramicidin C Biological activity Gramicidin C is a naturally occuring polypeptide antibiotic isolated from B. brevis var. G.B. Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Gramicidin S (Gramicidin soviet) is a cationic cyclic peptide antibiotic that selectively targets bacterial cell membranes and has anticancer activity. Gramicidin S also exerts antibacterial activity by disrupting membrane integrity and interfering with membrane protein functions. Gramicidin S inserts into the phospholipid bilayer via hydrophobic amino acid residues, specifically binds negatively charged membrane lipids and…
Gramicidin S analogue 9 is a bactericidal agent that can serve as a cyclic peptide analog. Gramicidin S analogue 9 disrupts bacterial cell membranes. Gramicidin S analogue 9 can be used in research on methicillin-resistant Staphylococcus aureus infections. Product Details Product Name Gramicidin S analogue 9 Biological activity Gramicidin S analogue 9 is a bactericidal…
Griselimycin is a cyclic depsipeptide that can be produced by Streptomyces. Griselimycin specifically binds to the bacterial DNA polymerase sliding clamp and does not interact with human PCNA. Griselimycin has potent antibacterial activity against Mycobacterium tuberculosis (including drug-resistant strains) and a variety of Gram-negative bacteria. Product Details Product Name Griselimycin Biological activity Griselimycin is a…
Product Name GIP (1-39) Biological activity GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration (i), and capable of enhancing exocytosis. CAS Number 725474-97-5 Sequence Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn Sequence Shortening Sequence Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN…
Product Name Cholecystokinin-33 free acid Biological activity Cholecystokinin-33 free acid is an analogue of Cholecystokinin (HY-P2932). C-terminal amidation is important for binding of Cholecystokinin to its receptors, and removing the amide group would decrease Cholecystokinin activity. Cholecystokinin-33 free acid can be used to study C-terminal amidation of Cholecystokinin-33. Appearance Solid Color White to off-white Sequence…
GVLSNVIGYLKKLGTGALNAVLKQ is an antimicrobial peptide with 24 amino acids. GVLSNVIGYLKKLGTGALNAVLKQ may form an ??-helix. GVLSNVIGYLKKLGTGALNAVLKQ (PGQ) is active against Gram-negative bacteria, Gram-positive bacteria, and the yeast Candida albicans. Product Details Product Name GVLSNVIGYLKKLGTGALNAVLKQ Biological activity GVLSNVIGYLKKLGTGALNAVLKQ is an antimicrobial peptide with 24-amino acid. GVLSNVIGYLKKLGTGALNAVLKQ can potentially form ??-helix. GVLSNVIGYLKKLGTGALNAVLKQ (PGQ) has activity against Gram-negative, Gram-positive…
Gy-CATH is an anionic antimicrobial peptide. Gy-CATH activates the MAPK and NF-??B signaling pathways (with elevated phosphorylation levels of ERK, p38, JNK, p65, and I??B??). Gy-CATH upregulates the expression levels of three physiological anticoagulant pathways. Gy-CATH inhibits ADP-, collagen-, and PMA-induced platelet aggregation. Gy-CATH has no direct antibacterial activity itself, but has significant protective effects…
Gymnin is a defensin-like antifungal peptide. Gymnin has significant antifungal activity against plant pathogenic fungi and toxigenic fungi. Gymnin inhibits HIV-1 reverse transcriptase with an IC50 of 200 ??M and inhibits tumor cell proliferation. Gymnin has weak mitogenic activity on mouse spleen cells. Gymnin can be used in research on plant diseases. Product Details Product…
H-Lys-Trp-Lys-OH is a small molecule peptide with antibacterial and antiviral activities, derived from patent CN 104072579 A, compound AMP12. Product Details Product Name H-Lys-Trp-Lys-OH Biological activity H-Lys-Trp-Lys-OH is a small molecule peptide which displays antibacterial and antiviral activities extracted from patent CN 104072579 A, Compound AMP12. Appearance Solid Color White to off-white Sequence H-Lys-Trp-Lys-OH Sequence…
Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Influenza A Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: Biotin-YPYDVPDYA-OH
Amount: 5 mg Application: Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Influenza A Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-YPYDVPDYA-OH
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Adenovirus (HAdV) Protein Name: Hexon protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GNNFAMEINLNANLW-OH Specifications: 15mer peptide as TFA salt
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
