Product Name Gastric Inhibitory Polypeptide (6-30) amide (human) Biological activity Gastric Inhibitory Polypeptide (6-30) amide (human) is an incretin hormone. Gastric Inhibitory Polypeptide (6-30) amide (human) can be used for the research of diabete. CAS Number 1139691-72-7 Sequence Sequence Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 Sequence Shortening Sequence Shortening FISDYSIAMDKIHQQDFVNWLLAQK-NH2 Storage Please store the product under the recommended conditions in…
Product Name Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse Biological activity Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner. Molecular Weight 3062.41 Formula Formula C128H205N45O39S2 CAS Number 88898-17-3 Appearance Solid Color White to off-white Sequence…
Product Name Urotensin I TFA Biological activity Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β…
Product Name Substance P, FAM-labeled Biological activity Substance P, FAM-labeled is a FAM labeled Substance P (HY-P0201). Sequence Sequence FAM-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening FAM-RPKPQQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GLP-2(rat) (Ala-13C3,15N) Biological activity GLP-2(rat) (Ala-13C3,15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Molecular Weight 3800.11 Formula Formula C16313C3H256N4315NO56S Sequence Sequence His-{Ala-13C3,15N}-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Sequence Shortening…
Product Name Neuropeptide Y, porcine Biological activity Neuropeptide Y, porcine, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion. CAS Number 83589-17-7 Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
GLR-19 is an anti-HIV peptide. GLR-19 also has antiviral activity against HSV-2. Product Details Product Name GLR-19 Biological activity GLR-19 is an anti-HIV peptide. GLR-19 also has antiviral activity against HSV-2. Sequence Gly-Leu-Arg-Arg-Leu-Leu-Gly-Arg-Leu-Leu-Arg-Arg-Leu-Gly-Arg-Leu-Leu-Leu-Arg Sequence Shortening GLRRLLGRLLRRLGRLLLR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P Biological activity Substance P (Neurokinin P) is a CNS-penetrant neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1347.63 Formula Formula C63H98N18O13S CAS Number 33507-63-0 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2
Product Name Neuropeptide Y (human,rat,mouse) Biological activity Neuropeptide Y (human,rat,mouse) is involved in Alzheimer’s disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Formula Formula C189H285N55O57S CAS Number 90880-35-6 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2…
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation. Product Information Product Name Glucagon (1-29), bovine, human hydrochloride Molecular Weight 3519.21 Formula C153H226ClN43O49S CAS Number 28270-04-4 Appearance Solid Color White to off-white Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr…
Glucagon (1-29), FAM-labeled is a biological active peptide. (FAM labeled HY-P0082) Product Information Product Name Glucagon (1-29), FAM-labeled Molecular Weight 3841.04 Formula C153H225N43O49S Appearance Solid Color Light yellow to yellow Sequence {FAM}-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Sequence Shortening {FAM}-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C,…
Product Name Systemin Biological activity Systemin, an 18-amino acid polypeptide, has been isolated from tomato leaves that is a powerful inducer of over 15 defensive genes. Formula Formula C85H144N26O28S CAS Number 137181-56-7 Appearance Solid Color White to off-white Sequence Sequence Ala-Val-Gln-Ser-Lys-Pro-Pro-Ser-Lys-Arg-Asp-Pro-Pro-Lys-Met-Gln-Thr-Asp Sequence Shortening Sequence Shortening AVQSKPPSKRDPPKMQTD
Product Name β-Casomorphin, bovine Biological activity β-Casomorphin, bovine (β-Casomorphin-7 (bovine) ) is a opioid peptide with an IC50 of 14 ??M in an Opioid receptors binding assay. Molecular Weight 789.92 Formula Formula C41H55N7O9 CAS Number 72122-62-4 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Phe-Pro-Gly-Pro-Ile Sequence Shortening Sequence Shortening YPFPGPI
Product Name α-Neoendorphin (1-8) Biological activity α-Neoendorphin (1-8) is a 8-amino acid peptide derived from the N-terminal of α-Neoendorphin. α-Neoendorphin is an endogenous opioid peptide. CAS Number 83339-89-3 Sequence Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr Sequence Shortening Sequence Shortening YGGFLRKY Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
