Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor. Product Information Product Name Glucagon-like peptide 1 (1-37), human Molecular Weight 4169.48 Formula C186H275N51O59 CAS Number 87805-34-3 Appearance Solid Color White to off-white Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year…
Product Name CRF, bovine TFA Biological activity CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces ovine CRF with a Ki of 3.52 nM. Molecular Weight 4697.34 (free base) Formula Formula C206H340N60O63S.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 Sequence Shortening Sequence Shortening SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 Storage Sealed storage, away from moisture…
Product Name Cortistatin 14 (mouse, rat) Biological activity Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus. CAS Number 193829-96-8 Appearance Solid…
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Protein Name: Glucose-6-phosphatase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KWCANPDWIHIDTTPFAGLV-OH Specifications: 20mer peptide as TFA salt
Glutathione oxidized (L-Glutathione oxidized) is produced by the oxidation of glutathione. Detoxification of reactive oxygen species is accompanied by production of glutathione oxidized. Glutathione oxidized can be used for the research of sickle cells and erythrocytes. Product Information Product Name Glutathione oxidized Molecular Weight 612.63 Formula C20H32N6O12S2 CAS Number 27025-41-8 Appearance Solid Color White to…
Glutathione oxidized disodium is produced by the oxidation of glutathione which is a major intracellular antioxidant and detoxifying agent. Product Information Product Name Glutathione oxidized disodium Molecular Weight 656.59 Formula C20H30N6Na2O12S2 CAS Number 103239-24-3
Glutathionylspermidine is a peptide and a metabolite of E. coli. Product Information Product Name Glutathionylspermidine Molecular Weight 434.55 Formula C17H34N6O5S CAS Number 33932-35-3 ?ṹ???? Others ??ʼ??Դ ??Դ?Դ?л?? ?˳????????л??
Product Name Neuromedin S (human) Biological activity Neuromedin S (human) is a neuropeptide that contains 33 amino acids. Neuromedin S (human)has been identified in the brain as an endogenous ligand for the orphan G-protein coupled receptor (GPCR) FM-4/TGR-1 and acts on the neuromedin U (NMU) receptor 2 (NMUR2) in the regulation of body weight homeostasis….
Product Name [His11]Substance P Biological activity Substance P is an analog of Substance P (HY-P0201). Substance P is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-His-NH2 Sequence Shortening Sequence Shortening RPKPQQFFGLH-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
