Product Name GIP (3-42), human Biological activity GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo. Molecular Weight 4749.4 Formula Formula C214H324N58O63S CAS Number 1802086-25-4 Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln Sequence Shortening Sequence Shortening EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Product Name pTH (44-68) (human) Biological activity pTH (44-68) (human) is apTH ((Human parathyroid hormone) fragment. CAS Number 64421-69-8 Sequence Sequence Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly Sequence Shortening Sequence Shortening RDAGSQRPRKKEDNVLVESHEKSLG Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Proadrenomedullin (N-20) (bovine, porcine) Biological activity Proadrenomedullin (N-20) (ProADM N20) (bovine, porcine) is a potent and noncompetitive hypotensive and catecholamine release-inhibitory peptide released from chromaffin cells. Proadrenomedullin (N-20) (bovine, porcine) inhibits catecholamine secretion with an IC50 of 350 nM in PC12 pheochromocytoma cells. Proadrenomedullin (N-20) (bovine, porcine) also blocks (EC50??270 nM) nicotinic cholinergic…
Product Name Buccalin Biological activity Buccalin is a neuropeptide that colocalizes with small molecule cardioactive peptides in neuronal B15. When exogenously applied to the ARC neuromuscular junction, Buccalin reduces the amplitude of muscle contraction induced by motor neuron firing and acts only presynaptically. Buccalin has no effect on the rate of muscle relaxation and reduces…
Product Name Angiotensin I (human, mouse, rat) Biological activity Angiotensin I is a decapeptide hormone. Angiotensin I is the precursor of Angiotensin II (HY-13948). Angiotensin I can be used in the study of cardiovascular diseases such as hypertension and vasospasm. Molecular Weight 1296.48 Formula Formula C62H89N17O14 CAS Number 484-42-4 Appearance Solid Color White to off-white…
Product Name GLP-1(9-36)amide Biological activity GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor. Formula Formula C140H214N36O43 CAS Number 161748-29-4 Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage Sealed storage,…
Product Name α-CGRP (mouse, rat) Biological activity α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the…
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Product Information Product Name GIP, human Molecular Weight 4983.60 Formula C226H338N60O66S CAS Number…
Product Name Insulin (swine) Biological activity Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin…
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Product Information Product Name GIP, human TFA Molecular Weight 4983.53 (free…
Product Name Pancreastatin Biological activity Pancreastatin is a biological active peptide. (Pancreastatin (PST) enhances hepatic glucose output leading to diabetes. ) CAS Number 113817-19-9 Appearance Solid Color White to off-white Sequence Sequence Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 Sequence Shortening Sequence Shortening PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name Urocortin III, mouse TFA Biological activity Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics. Appearance Solid Color White to…
Glepaglutide (ZP1848), a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide reduces faecal output and increases intestinal absorption. Glepaglutide alleviates small intestinal inflammation. Glepaglutide can be used in the research of inflammatory bowel disease (IBD) and Crohn??s disease. Product Information Product Name Glepaglutide Molecular Weight 4316.08 Formula C197H325N53O55 CAS Number 914009-86-2 Appearance Solid Color…
Glepaglutide (ZP1848) acetate, a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide acetate reduces faecal output and increases intestinal absorption. Glepaglutide acetate alleviates small intestinal inflammation. Glepaglutide acetate can be used in the research of inflammatory bowel disease (IBD) and Crohn??s disease. Product Information Product Name Glepaglutide acetate Molecular Weight 4376.06 Formula C199H329N53O57 Appearance…
GLK-19 is an antimicrobial peptide with anti-E. coli activity (MIC: 10 ??M). Product Details Product Name GLK-19 Biological activity GLK-19 is an antimicrobial peptide, and is active against E. coli (MIC: 10 ??M). CAS Number 1225014-04-9 Sequence Gly-Leu-Lys-Lys-Leu-Leu-Gly-Lys-Leu-Leu-Lys-Lys-Leu-Gly-Lys-Leu-Leu-Leu-Lys Sequence Shortening GLKKLLGKLLKKLGKLLLK Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Globomycin is a lipopeptide antibiotic and an inhibitor of signal peptidase II (LspA). Globomycin inhibits prolipoprotein processing by irreversibly binding to the peptidase. Globomycin is toxic to Spiroplasma melliferum, with MIC values in the range of 6.25-12.5 ??M. Product Details Product Name Globomycin Biological activity Globomycin is a lipopeptide antibiotic and a signal peptidase II…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
