store

  • Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) p60  217-225, KYGVSVQDI

    Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) p60 217-225, KYGVSVQDI

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Listeriosis Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Listeria Protein Name: Probable protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KYGVSVQDI-OH Specifications: 9mer peptide as TFA salt

  • Listeria monocytogenes serotype 1/2a (strain 08-5578) Listeriolysin O  190-201, NEKYAQAYPNVS

    Listeria monocytogenes serotype 1/2a (strain 08-5578) Listeriolysin O 190-201, NEKYAQAYPNVS

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Listeria Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-NEKYAQAYPNVS-OH Specifications: 12mer peptide as TFA salt

  • LL-37 Peptide

    LL-37 Peptide

    Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Human Purity: >95% (HPLC-MS) Quantification: No Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH Specifications: Antimicrobial peptide

  • Lordsdale virus (strain GII/Human/United Kingdom/Lordsdale/1993) VP1  181-195, MLYTPLRANNAGDDV

    Lordsdale virus (strain GII/Human/United Kingdom/Lordsdale/1993) VP1 181-195, MLYTPLRANNAGDDV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Lordsdale virus Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MLYTPLRANNAGDDV-OH Specifications: 15mer peptide as TFA salt

  • Louping ill virus (Capsid Protein)

    Louping ill virus (Capsid Protein)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Fever, Infection, Neurodegeneration, Zoonosis Layout: Freeze-dried in glass vial Organism: Louping ill virus Protein Name: Capsid protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification:…

  • Lymphocytic choriomeningitis virus (NCAP)

    Lymphocytic choriomeningitis virus (NCAP)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Lymphocytic choriomeningitis, Meningitis Layout: Freeze-dried in glass vial Organism: Lymphocytic choriomeningitis virus Protein Name: Membrane protein, Nucleocapsid protein Purity: >70% (HPLC-MS), Development Grade:…

  • Lysine Peptide

    Lysine Peptide

    Application: Cosmetics Category: Cosmetic Peptides (DPRA Peptides) Layout: Freeze-dried in plastic vial Purity: >95% (HPLC-MS) Quantification: No Sequence: Ac-RFAAKAA-OH Specifications: 9mer peptide as TFA salt

  • M. bovis (strain ATCC BAA-935 / AF2122/97) Ag85B  239-247, KLVANNTRL

    M. bovis (strain ATCC BAA-935 / AF2122/97) Ag85B 239-247, KLVANNTRL

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Tuberculosis Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mycobacterium bovis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KLVANNTRL-OH Specifications: 9mer peptide as TFA salt

  • M. bovis (strain ATCC BAA-935 / AF2122/97) Ag85B  242-250, ANNTRLWVY

    M. bovis (strain ATCC BAA-935 / AF2122/97) Ag85B 242-250, ANNTRLWVY

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Tuberculosis Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mycobacterium bovis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ANNTRLWVY-OH Specifications: 9mer peptide as TFA salt

  • M. tuberculosis (ACR)

    M. tuberculosis (ACR)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Alpha-crystallin Purity: >70% (HPLC-MS), Development…

  • M. tuberculosis (Ag85A)

    M. tuberculosis (Ag85A)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: Development Grade: each peptide purified…

  • M. tuberculosis (Ag85B)

    M. tuberculosis (Ag85B)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: >70% (HPLC-MS), Development Grade: each…

  • M. tuberculosis (Antitoxin VapB47)

    M. tuberculosis (Antitoxin VapB47)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Antitoxin Purity: Development Grade: each peptide purified to…

  • M. tuberculosis (CFP-10)

    M. tuberculosis (CFP-10)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: ESAT-6-like protein Purity: >70% (HPLC-MS), Development Grade: each…

  • M. tuberculosis (ESAT-6)

    M. tuberculosis (ESAT-6)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: ESAT-6 Purity: >70% (HPLC-MS), Development Grade: each peptide…

  • M. tuberculosis (EspA)

    M. tuberculosis (EspA)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase, ESX-1 secretion-associated protein EspA Purity: >70%…