Product Name Galanin-Like Peptide (rat) Biological activity Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism. CAS Number 245114-97-0 Sequence Sequence Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Ser-Ser-Lys-Ala-Asn-Gln-Gly-Arg-Lys-Thr-Asp-Ser-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-Arg-Ser-Pro-Arg-Met-Thr Sequence Shortening Sequence Shortening APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT Storage Please store the product under the recommended conditions in the…
Gallin is an antimicrobial peptide derived from egg white. Gallin inhibits the growth of Escherichia coli at a concentration of 0.25 ??M. Product Details Product Name Gallin Biological activity Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 ??M concentration. Sequence Shortening LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) Storage…
Ganirelix is a competitive and selective gonadotropin releasing hormone (GnRH) antagonist. Ganirelix prevents endogenous GnRH from inducing luteinising hormone (LH) and follicle stimulating hormone release. Ganirelix counteracts Prostaglandin E2 (HY-101952)-induced detrusor overactivity, enhances Carbachol (HY-B1208)-induced detrusor contractions. Ganirelix can be used for the research of female infertility and detrusor overactivity. Product Information Product Name Ganirelix…
Garvicin KS, GakA is a peptide composed of 34 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakB and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS (GakA with GakB) is an effective combination with good peptide stability, antibacterial efficacy, and fibroblast viability/proliferation effects. The Garvicin…
Garvicin KS, GakB is a peptide composed of 34 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakA and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS (GakB with GakA) is an effective combination with good peptide stability, antibacterial efficacy, and fibroblast viability/proliferation effects. The Garvicin…
Garvicin KS, GakC is a peptide composed of 32 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakA and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. The Garvicin KS peptides inhibit MSSA, with the MIC value order GakB > GakC > GakA. Product Details Product Name Garvicin…
Product Name TT-232 Biological activity TT-232 (CAP-232), a somatostatin derivative, is a peptide SSTR1/SSTR4 agonist. TT-232 inhibits cancer cell proliferation and induces apoptosis. TT-232 is also a broad-spectrum anti-inflammatory and analgesic agent. Molecular Weight 947.13 Formula Formula C45H58N10O9S2 CAS Number 147159-51-1 Appearance Solid Color White to off-white
Product Name Acetyl Gastric Inhibitory Peptide (human) Biological activity Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity. Molecular Weight 5025.6 Formula Formula C228H340N60O67S CAS Number 299898-33-2…
Product Name Hypertrehalosemic neuropeptide (Nauphoeta cinerea) Biological activity Hypertrehalosemic neuropeptide (Nauphoeta cinerea) is a neuropeptide in the adipokinetic hormone/red pigment-concentrating hormone (AKH/RPCH) family, and can stimulate the synthesis of trehalose. CAS Number 106018-36-4 Sequence Sequence {pGlu}-Val-Asn-Phe-Ser-Pro-Gly-Trp-Gly-Thr-NH2 Sequence Shortening Sequence Shortening {pGlu}-VNFSPGWGT-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name ACTH (1-14) TFA Biological activity ACTH (1-14) (TFA) is a fragment of adrenocorticotrophin, which regulates cortisol and androgen production. Formula Formula C79H110F3N21O22S Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly Sequence Shortening Sequence Shortening SYSMEHFRWGKPVG Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name pTH (44-68) (human) TFA Biological activity pTH (44-68) (human) TFA is a fragment of human parathyroid hormone (pTH) that lacks the adenylate cyclase-stimulating activity of intact pTH. pTH (44-68) (human) TFA can be used to study the mechanism of action of pTH. Appearance Solid Color White to off-white Sequence Sequence Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly Sequence Shortening…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
