Insert HTML here
Showing 1425–1440 of 3705 results
Gageotetrin A is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin A has antifungal activity but is non-toxic to many human cancer cells. Product Details Product Name Gageotetrin A Biological activity Gageotetrin A is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin A has antifungal activity, but none toxic…
Gageotetrin B has antibacterial activity. Compared with bacteria, Gageotetrin B has stronger inhibitory activity against fungi, with MIC values of 0.01-0.04 ??M. Product Details Product Name Gageotetrin B Biological activity Gageotetrin B has antimicrobial activities. Gageotetrin B is more active against fungi compared to bacteria with MIC values of 0.01-0.04 ??M. Sequence {HTDA}-{Glu(OMe)}-Leu-Leu-Leu Sequence Shortening…
Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC values of 0.02-0.04 ??M). Product Details Product Name Gageotetrin C Biological activity Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC value…
Galacto-RGD is an RGD analogue that can be coupled with the radioactive isotope 18F and used as an integrin α β selective tracer. Galacto-RGD can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs). Product Information Product Name Galacto-RGD Molecular Weight 792.84 Formula C34H52N10O12 CAS Number 922175-70-0 Sequence Cyclo(Arg-Gly-Asp-{d-Phe}-{Lys(SAA)}) Sequence Shortening Cyclo(RGD-{d-Phe}-{Lys(SAA)})
Product Name Dafphedyn Biological activity Dafphedyn is an analogue of Dynorphin (1-13). Dafphedyn has diuretic and profound analgesia effects that can be antagonized by centrally administered Naltrexone (HY-76711) or Naloxone (HY-17417A). Formula Formula C76H124F5N25O14 CAS Number 111846-43-6 Sequence Sequence Tyr-{d-Ala}-Gly-{Phe(F5)}-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2 Sequence Shortening Sequence Shortening Y-{d-Ala}-G-{Phe(F5)}-LRRIRPKLK-NH2 Storage Please store the product under the recommended conditions in…
Product Name Galanin (swine) Biological activity Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98,…
Product Name Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse TFA Biological activity Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner. Molecular Weight 3176.43 Formula Formula C130H206N45F3O41S2 Appearance Solid Color White to off-white Sequence Sequence…
Product Name ACTH (1-17) TFA Biological activity ACTH (1-17) TFA, an adrenocorticotropin analogue, is a potent human melanocortin 1 (MC1) receptor agonist with a Ki of 0.21 nM. Molecular Weight 2207.43 Formula Formula C95H145N29O23S.C2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKR
Product Name GLP-2(rat) TFA Biological activity GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Sequence Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Sequence Shortening Sequence Shortening HADGSFSDEMNTILDNLATRDFINWLIQTKITD Storage Please store the product under the recommended conditions…
Product Name Corticotropin-releasing factor (Sheep) Biological activity Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor…
Product Name Peptide YY (PYY), human Biological activity Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors. Molecular Weight 4309.75 Formula Formula C194H295N55O57 CAS Number 118997-30-1 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence…
Product Name Schistoflrfamide Biological activity Schistoflrfamide, a FMRFamide-related peptide, is an inhibitory neuropeptide. Schistoflrfamide decreases the amplitude and frequency of myogenic contractions and reduce basal tension visceral muscle. CAS Number 121801-61-4 Sequence Sequence Pro-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening PDVDHVFLRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Katacalcin TFA Biological activity Katacalcin TFA (PDN 21 TFA) is a potent plasma calcium-lowering peptide. Formula Formula C99H155F3N34O38S2 Appearance Solid Color White to off-white Sequence Sequence Asp-Met-Ser-Ser-Asp-Leu-Glu-Arg-Asp-His-Arg-Pro-His-Val-Ser-Met-Pro-Gln-Asn-Ala-Asn Sequence Shortening Sequence Shortening DMSSDLERDHRPHVSMPQNAN Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1…
Product Name Adrenomedullin (11-50), rat Biological activity Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors. CAS Number 163648-32-6 Sequence Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9) Sequence Shortening Sequence Shortening STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9) Storage Please store the product under the recommended conditions in the…
Product Name Galanin-Like Peptide (human) Biological activity Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism. CAS Number 245114-99-2 Sequence Sequence Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser Sequence Shortening Sequence Shortening APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS Storage Please store the product under the recommended conditions in the…
Product Name Galanin-Like Peptide (porcine) Biological activity Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide that was first isolated from the porcine hypothalamus. Galanin-Like Peptide (porcine) has a high affinity for the GALR2 receptor (IC50 of 0.24 nM) and a lower affinity for the GALR1 receptor (IC50 of 4.3 nM). CAS Number 245114-96-9 Sequence…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us