Cecropin D
Description
Cecropin D is an antimicrobial peptide with an MIC of 4.55 ??g/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, anti-tumor, and immunomodulatory effects.
Product Details
| Product Name | Cecropin D |
| Biological activity | Cecropin D is an antimicrobial peptide with a MIC of 4.55 ??g/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory. |
| Sequence | Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala-Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2 |
| Sequence Shortening | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2 |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
