Insert HTML here
Showing 641–656 of 3705 results
Category: Antigen Peptides Layout: Freeze-dried in plastic vial Organism: Varicella-zoster virus (VZV) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TSPLLRYAAWTGGLA-OH
Category: Antigen Peptides Layout: Freeze-dried in plastic vial Organism: Varicella-zoster virus (VZV) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALNARGVLLLSTRDLAFAGA-OH
Category: Antigen Peptides Layout: Freeze-dried in plastic vial Organism: Varicella-zoster virus (VZV) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ILIEGIFFV-OH
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer, Wilms tumor 1 Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Wilms tumor protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-RMFPNAPYL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Wilms tumor protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-VLDFAPPGA-OH
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer, Wilms tumor 1 Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Wilms tumor protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-CMTWNQMNL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Yellow Fever Layout: Freeze-dried in plastic vial Organism: Yellow Fever Virus (YFV) Protein Name: Genome polyprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LLWNGPMAV-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Zinc transporter Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-FLLSLFSLWL-OH Specifications: 10mer peptide as TFA salt
Antimicrobial Peptide YD is an antimicrobial peptide. Antimicrobial Peptide YD attenuates the TLR4/MYD88/NF-??B signaling pathway, inhibits ROS production, upregulates antioxidant enzyme expression, reduces levels of inflammation-related factors, and prevents E-cadherin downregulation and Vimentin upregulation. Antimicrobial Peptide YD is active against Gram-positive bacteria, Gram-negative bacteria, and multidrug-resistant strains. Antimicrobial Peptide YD has anti-inflammatory, anti-fibrotic, and antioxidant…
Antimicrobialpeptide 6b is a cationic macrocyclic antimicrobial peptide. Antimicrobialpeptide 6b has broad-spectrum antibacterial and antifungal activity, with MICs of 1.5-6.2 ??g/mL against drug-resistant Gram-positive bacteria, 4-25 ??g/mL against Gram-negative bacteria, and activity against pathogenic fungi. It acts through a membrane-lytic mechanism, possesses a unique “sandwich” conformation, has low hemolytic activity, and rapidly kills bacteria and…
Antioxidant peptide A is a short peptide, which contains alternative aromatic or sulfur-containing amino acid. The side chains of Antioxidant peptide A are believed to contribute to strong radical scavenging activities of peptides in the cancer cell. Product Information Product Name Antioxidant peptide A Molecular Weight 770.97 Formula C31H54N12O7S2 CAS Number 159147-88-3 Sequence Pro-His-Cys-Lys-Arg-Met Sequence…
Antitumor agent-39 is a peptide compound with anticancer effect (US20050009751A1, compound 64). Product Information Product Name Antitumor agent-39 Molecular Weight 732.01 Formula C40H69N5O7 CAS Number 159255-72-8
Anvoglutide is a glucagon-like peptide 1 (GLP-1) receptor agonist with antidiabetic and obesity effects. Product Information Product Name Anvoglutide Molecular Weight 4213.69 Formula C192H299N45O61 CAS Number 3091730-40-1 Sequence {His(Aib)}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-{Lys(AEEA-AEEA-γGlu-C20 diacid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening {His(Aib)}-EGTFTSDVSSYLEEQAA-{Lys(AEEA-AEEA-γGlu-C20 diacid)}-EFIAWLVRGRG
Product Name [Pro3]-GIP (Rat) Biological activity -GIP (Rat) is a selective GIP receptor partial agonist with a Ki of 13 nM. -GIP (Rat) can be used in diabetes research. Sequence Sequence Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln Sequence Shortening Sequence Shortening YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
APH-IN-1 is an aminoglycoside phosphotransferase (APH) inhibitor with a Kd value of 63 nM against E. coli APH(3??)-Ia. APH-IN-1 binds mainly to the ATP-binding pocket of APH(3??)-Ia in an ATP-competitive manner, and divalent metal ions (Mg2+ and Ca2+) enhance binding affinity. APH-IN-1 can be used in research on aminoglycoside-resistant bacterial infections. Product Details Product Name…
Api137 is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 inhibits protein synthesis by trapping release factors on the 70S ribosome after hydrolysis of the nascent polypeptide chain. Product Details Product Name Api137 Biological activity Api137 is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 inhibits protein…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us