ArraySlide 24-1 chamber
Application: B-cell Immunity, Protein-protein-interaction Category: PepStar Accessories Layout: 21-sample peptide microarray Quantification: No
Showing 673–688 of 3705 results
-
-
Arylomycin A2
Arylomycin A2 is an antibiotic and a lipopeptide inhibitor of type I signal peptidase (SPase I). Arylomycin A2 has antibacterial effects. Product Details Product Name Arylomycin A2 Biological activity Arylomycin A2, an antibiotic (Antibiotic), is a lipopeptide type I signal peptidase (SPase I) inhibitor. Arylomycin A2 has antibacterial effects. Formula C42H60N6O11 CAS Number 459844-20-3 Appearance…
-
ASB20123
ASB20123 is a CNP/ghrelin chimeric peptide. ASB20123 stimulate bone growth. ASB20123 can be used in research of growth disorders and dwarfism. Product Information Product Name ASB20123 Molecular Weight 4183.93 Formula C180H309N57O51S3 Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Val-Gln-Gln-Arg-Lys-Asp-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg (Disulfide bridge: Cys6-Cys22) Sequence Shortening GLSKGCFGLKLDRIGSMSGLGCVQQRKDSKKPPAKLQPR (Disulfide bridge: Cys6-Cys22)
-
ASP-1
ASP-1 is an active and potent anti-staphylococcal peptide with minimum inhibitory concentrations (MICs) of 2 ??g/mL-64 ??g/mL against Staphylococcus aureus and methicillin-resistant Staphylococcus aureus (MRSA). Product Details Product Name ASP-1 Biological activity ASP-1 is a strong antistaphylococcal peptide with minimum inhibitory concentrations (MICs) of the purified peptide against S. aureus and methicillin-resistant S. aureus (MRSA)…
-
Aspartocin D
Aspartocin D is an analog of Amphomycin (HY-P3078). Aspartocin D has antibacterial activity against Gram-positive bacteria. Product Details Product Name Aspartocin D Biological activity Aspartocin D is an analogue of Amphomycin (HY-P3078). Aspartocin D shows antimicrobial activities against Gram-positive bacteria. Sequence {??3-Isododecenoic acid}-Asp-cyclo({2,3-Dab}-{d-Pip}-{Asp(Me)}-Asp-Gly-Asp-Gly-{2,3-Dab}-Val-Pro) Sequence Shortening {??3-Isododecenoic acid}-D-cyclo({2,3-Dab}-{d-Pip}-{Asp(Me)}-DGDG-{2,3-Dab}-VP) Storage Please store the product under the recommended…
-
Aspergillus fumigatus (Glucanosyltransferase gel1)
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Allergy, Infection, Respiratory infection Layout: Freeze-dried in glass vial Organism: Aspergillus fumigatus Protein Name: Glucanosyltransferase Purity: >70% (HPLC-MS), Development Grade: each peptide purified to…
-
Aspergillus fumigatus (Probable glycosidase crf1)
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Allergy, Infection, Respiratory infection Layout: Freeze-dried in glass vial Organism: Aspergillus fumigatus Protein Name: Probable glycosidase crf1 Purity: >70% (HPLC-MS), Development Grade: each peptide…
-
Astacidin 1
Astacidin 1 is an antibacterial peptide. Astacidin 1 can be produced by proteolytic cleavage of hemocyanin under acidic conditions. Astacidin 1 has broad-spectrum antibacterial activity against both Gram-positive and Gram-negative bacteria. Product Details Product Name Astacidin 1 Biological activity Astacidin 1 is an antibacterial peptide. Astacidin 1 can be produced by a proteolytic cleavage from…
-
Astepatide
Astepatide is a gastric inhibitory peptide (GIP) receptor and glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in anti-diabetic research. Product Information Product Name Astepatide Molecular Weight 4853.48 Formula C226H348N50O68 CAS Number 2959444-13-2 Sequence Tyr-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Leu-Leu-Glu-Lys-{Lys-Lys-γGlu-C18 diacid}-Gln-Ala-Ala-Arg-Glu-Phe-Ile-Glu-Trp-Leu-Leu-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser Sequence Shortening Y-{Aib}-EGTFTSDYSILLEK-{Lys-Lys-γGlu-C18 diacid}-QAAREFIEWLLAGGPSSGAPPPS
-
Atilmotin
OHM 11638 (Atilmotin), an analogue of the (1-14) fragment of porcine motilin, is a motilin receptor agonist with a pKd of 8.94 for the motilin receptor. OHM 11638 affects esophageal, lower esophageal sphincter (LES), and gastric motility. OHM 11638 increases LES and gastric pressures, OHM 11638 can be used as prokinetic agents. Product Information Product…
-
Atosiban
Atosiban (RW22164; RWJ22164) is a nonapeptide competitive vasopressin/oxytocin receptor antagonist, and is a desamino-oxytocin analogue. Atosiban is the main tocolytic agent and has the potential for spontaneous preterm labor research. Product Information Product Name Atosiban Molecular Weight 994.19 Formula C43H67N11O12S2 CAS Number 90779-69-4 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture…
-
AtPep3
Product Name PEN(mouse) Biological activity PEN(mouse) (proSAAS(221-242)) is the precursor of a number of peptides that function as neuropeptides. CAS Number 1236955-25-1 Sequence Shortening Sequence Shortening SVDQDLGPEVPPENVLGALLRV Storage Please store the product under the recommended conditions in the Certificate of Analysis.
-
AtPep3 TFA
Product Name Spexin TFA Biological activity Spexin (Neuropeptide Q) TFA is a selective agonist of galanin receptors GAL2 and GAL3, and is a conserved peptide that functions as a neurotransmitter/neuromodulator and endocrine factor. Spexin TFA can function through both central and peripheral actions. Spexin TFA upregulates Beclin 1 to inhibit ferroptosis induced by excessive autophagy,…
-
Atrial Natriuretic Factor (5-27) (human)
Product Name (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Biological activity (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field…
-
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
Product Name [D-Lys6]-LH-RH Biological activity -LH-RH is a Luteinizing-hormone-releasing hormone (LHRH) analogue. -LH-RH acts as a GnRH receptor agonist. Molecular Weight 1253.41 Formula Formula C59H84N18O13 CAS Number 52671-12-2 Appearance Solid Color White to off-white Sequence Sequence {Glp}-His-Trp-Ser-Tyr-{d-Lys}-Leu-Arg-Pro-Gly-NH2 Sequence Shortening Sequence Shortening {Glp}-HWSY-{d-Lys}-LRPG-NH2
-
Atrial natriuretic peptide (3-28) (human)
Product Name Neuropeptide W-23 (human) Biological activity Neuropeptide W-23 (human) (NPW-23), the active form of Neuropeptide W, is an endogenous agonist of NPBW1 (GPR7) and NPBW2 (GPR8). Molecular Weight 2584.01 Formula Formula C119H183N35O28S CAS Number 383415-79-0 Appearance Solid Color White to off-white Sequence Sequence Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu Sequence Shortening Sequence Shortening WYKHVASPRYHTVGRAAGLLMGL
