Insert HTML here
Showing 689–704 of 3705 results
Product Name PACAP (1-38) free acid Biological activity PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells. Formula Formula C203H330N62O54S CAS Number 129405-61-4 Appearance…
Product Name Urocortin III, mouse Biological activity Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics. CAS Number 357952-10-4 Appearance Solid Color White…
Product Name Calcitonin (chicken) Biological activity Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts. CAS Number 100016-62-4 Sequence Sequence Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7) Storage Please store the product under the recommended conditions in…
Product Name Neuromedin (B-30) Biological activity Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord. , and may exhibit activity in stimulating smooth-muscle. Neuromedin B causes local vasodilation, increases vascular permeability and local hyperalgesia, thereby participating in neurogenic inflammation. Neuromedin B regulates appetite, body temperature, and behavioral responses to…
Product Name β-Endorphin, rat Biological activity β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats. CAS Number 59887-17-1 Sequence Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln Sequence Shortening Sequence Shortening YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ Storage Please store the product under the recommended conditions in the…
ATWLPPRAANLLMAAS is a chimeric peptide with anti-angiogenic and potent anti-tumor effects. ATWLPPRAANLLMAAS can inhibit the proliferation, viability, migration, and invasion of human hepatocellular carcinoma cells, and induce apoptosis.. Product Information Product Name ATWLPPRAANLLMAAS Molecular Weight 1682.98 Formula C76H123N21O20S CAS Number 1228447-26-4 Sequence Ala-Thr-Trp-Leu-Pro-Pro-Arg-Ala-Ala-Asn-Leu-Leu-Met-Ala-Ala-Ser Sequence Shortening ATWLPPRAANLLMAAS
Aurantimycin A is a depsipeptide antibiotic showing strong activity against Gram-positive bacteria. Aurantimycin A is a substrate of the LieAB transporter. Product Details Product Name Aurantimycin A Biological activity Aurantimycin A (Adipogen), a depsipeptide antibiotic, displays strong activity against Gram-positive bacteria. Aurantimycin A is a substrate of the LieAB transporter. Storage Please store the product…
Aurein 1.1 is an antibiotic peptide present in the Australian bell frog Litoria raniformis. Product Details Product Name Aurein 1.1 Biological activity Aurein 1.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria raniformis. Sequence Gly-Leu-Phe-Asp-Ile-Ile-Lys-Lys-Ile-Ala-Glu-Ser-Ile-NH2 Sequence Shortening GLFDIIKKIAESI-NH2 Storage Please store the product under the recommended conditions in the…
Aurein 1.2 is a C-terminally amidated antimicrobial peptide found in Litoria raniformis. Aurein 1.2 exhibits moderate, relatively broad-spectrum antibacterial activity against a variety of bacteria, with MIC values of 12-100 ??g/mL. Aurein 1.2 can form an amphipathic ??-helix with separate hydrophilic and hydrophobic faces, and may exert antibacterial and tumor cell cytotoxic effects by disrupting…
Aurein 2.1 is an antibiotic peptide present in the Australian bell frogs Litoria aurea and Litoria raniformis. Product Details Product Name Aurein 2.1 Biological activity Aurein 2.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria aurea and Litoria raniformis. Sequence Gly-Leu-Leu-Asp-Ile-Val-Lys-Lys-Val-Val-Gly-Ala-Phe-Gly-Ser-Leu-NH2 Sequence Shortening GLLDIVKKVVGAFGSL-NH2 Storage Please store the product…
Aurein 2.2 is a major component of the skin secretions of L. aurea. Aurein 2.2 is an antibiotic with broad-spectrum antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus. Product Details Product Name Aurein 2.2 Biological activity Aurein 2.2 is a major component of the skin secretion of L.aurea. Aurein 2.2 is an antibiotic with…
Aurein 2.3 is an antibiotic antimicrobial peptide. Aurein 2.3 partially inhibits E. coli ATPase activity and inhibits bacterial growth. Product Details Product Name Aurein 2.3 Biological activity Aurein 2.3 is an antibiotic antimicrobial peptide. Aurein 2.3 partially inhibits E.coli ATPase activity and inhibits cell growth. Sequence Gly-Leu-Phe-Asp-Ile-Val-Lys-Lys-Val-Val-Gly-Ala-Ile-Gly-Ser-Leu-NH2 Sequence Shortening GLFDIVKKVVGAIGSL-NH2 Storage Please store the product…
Aurein 2.4 is an antibiotic antimicrobial peptide. Aurein 2.4 is active against Gram-positive bacteria. Product Details Product Name Aurein 2.4 Biological activity Aurein 2.4 is an antibiotic antimicrobial peptide. Aurein 2.4 is active against Gram-positive bacterial. Sequence Gly-Leu-Phe-Asp-Ile-Val-Lys-Lys-Val-Val-Gly-Thr-Leu-Ala-Gly-Leu-NH2 Sequence Shortening GLFDIVKKVVGTLAGL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Aurein 2.5 is an antibiotic antimicrobial peptide. Aurein 2.5 has antibacterial and antifungal activities. Product Details Product Name Aurein 2.5 Biological activity Aurein 2.5 is an antibiotic antimicrobial peptide. Aurein 2.5 has antibacterial and antifungal activity Sequence Gly-Leu-Phe-Asp-Ile-Val-Lys-Lys-Val-Val-Gly-Ala-Phe-Gly-Ser-Leu-NH2 Sequence Shortening GLFDIVKKVVGAFGSL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Aurein 2.6 is an antibiotic antimicrobial peptide. Aurein 2.6 has antibacterial activity against Gram-positive bacteria (MICs of 25, 25, 30, 25, and 30 ??M against M. luteus, S. aureus, S. epidermis, S. mutans, and B. subtilis, respectively). Product Details Product Name Aurein 2.6 Biological activity Aurein 2.6 is an antibiotic antimicrobial peptide. Aurein 2.6 is…
Aurein 3.1 is an antibiotic antimicrobial peptide. Aurein 3.1 has antibacterial activity against Gram-positive bacteria (MICs of 80, 50, 50, 50, and 50 ??M against M. luteus, S. aureus, S. epidermis, S. mutans, and B. subtilis, respectively). Product Details Product Name Aurein 3.1 Biological activity Aurein 3.1 is an antibiotic antimicrobial peptide. Aurein 2.6 is…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us