Rugecitide is a neuregulin 4 (NRG4) analog. Product Information Product Name Rugecitide Molecular Weight 5499.16 Formula C238H355N67O72S6 CAS Number 2938226-27-6 Sequence Gly-Gly-Gly-Gly-Ser-Gly-His-Glu-Glu-Pro-Cys-Gly-Pro-Ser-His-Lys-Ser-Phe-Cys-Leu-Asn-Gly-Gly-Leu-Cys-Tyr-Gln-Ile-Pro-Thr-Ile-Pro-Ser-Pro-Phe-Cys-Arg-Cys-Val-Glu-Asn-Tyr-Thr-Gly-Ala-Arg-Cys-Glu-Lys-Val-Phe-Leu (Disulfide bridge: Cys11-Cys25,Cys19-Cys36,Cys38-Cys47) Sequence Shortening GGGGSGHEEPCGPSHKSFCLNGGLCYQIPTIPSPFCRCVENYTGARCEKVFL (Disulfide bridge: Cys11-Cys25,Cys19-Cys36,Cys38-Cys47)
Rusalatide acetate (TP508 amide acetate), a regenerative peptide, mitigates radiation-induced gastrointestinal damage by activating stem cells and preserving crypt integrity. Product Information Product Name Rusalatide acetate Molecular Weight 2371.50 Formula C99H151N29O37S CAS Number 875455-82-6 Appearance Solid Color White to off-white Sequence Shortening AGYKPDEGKRGDACEGDSGGPFV-NH2 Sequence Shortening AGYKPDEGKRGDACEGDSGGPFV-NH2 Storage Sealed storage, away from moisture and light Powder…
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis. Product Information Product Name Rusfertide Molecular Weight 2441.95 Formula C114H181N27O28S2 CAS Number 1628323-80-7 Appearance Solid Color White to off-white…
RW3 (MP196) is a small cationic antimicrobial hexapeptide. RW3 targets the bacterial cytoplasmic membrane and inhibits cell respiration and cell wall synthesis. RW3 exhibits high biological activity against Gram-positive bacteria (e.g., Bacillus subtilis 168, MIC 2 ??g/mL). RW3 causes contraction of mouse erythrocytes. RW3 can be used in research on antimicrobial and antifungal activities. Product…
S-Methylglutathione is an S-substitued?glutathione and a stronger nucleophile than GSH. S-Methylglutathione has inhibitory effect on glyoxalase 1. Product Information Product Name S-Methylglutathione Molecular Weight 321.35 Formula C11H19N3O6S CAS Number 2922-56-7 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
S-Thanatin is an insect antimicrobial peptide with potent broad-spectrum antibacterial activity. S-Thanatin inhibits the activity of Gram-negative bacteria, Gram-positive bacteria, and fungi, without cytotoxicity. The antibacterial activity of S-Thanatin is not affected by pH, but monovalent cations (Na+/K+) can reduce its bacteriostatic activity against Gram-negative bacteria in a dose-dependent manner. Product Details Product Name S-Thanatin…
SAAP 148 is a synthetic antimicrobial peptide that interacts with and damages the lipid bilayer of the bacterial cytoplasmic membrane, leading to altered membrane permeability and bacterial death. SAAP 148 kills drug-resistant, multidrug-resistant, and persister strains, inhibits biofilm formation, eradicates preformed biofilms, and blocks bacterial colonization of implant surfaces. SAAP 148 retains activity after modification…
SAAP 148 TFA is a synthetic antimicrobial peptide that interacts with and damages the lipid bilayer of the bacterial cytoplasmic membrane, leading to altered membrane permeability and bacterial death. SAAP 148 TFA kills drug-resistant, multidrug-resistant, and persister strains, inhibits biofilm formation, eradicates preformed biofilms, and blocks bacterial colonization of implant surfaces. SAAP 148 TFA retains…
SAAP Fraction 3 is an antimicrobial peptide. SAAP Fraction 3 has killing ability against P. haemolytica in zinc salt buffer. Product Details Product Name SAAP Fraction 3 Biological activity SAAP Fraction 3 is an antimicrobial peptide. SAAP Fraction 3 is active against P. haemolytica in Zn-saline buffer. Sequence Asp-Asp-Asp-Asp-Asp-Asp-Asp Sequence Shortening DDDDDDD Storage Please store…
SAIRGA is derived from bacteriophage phi3T and can recognize phAimR in the bacterial cytoplasm to promote lysogeny. Product Details Product Name SAIRGA Biological activity SAIRGA, derived from the phages phi3T, can recognize phAimR in the bacterial cytosol to induce lysogeny. Appearance Solid Color White to off-white Sequence Ser-Ala-Ile-Arg-Gly-Ala Sequence Shortening SAIRGA Storage Please store the…
SAIRGA (TFA) is derived from bacteriophage phi3T and can recognize phAimR in the bacterial cytoplasm to promote lysogeny. Product Details Product Name SAIRGA TFA Biological activity SAIRGA (TFA), derived from the phages phi3T, can recognize phAimR in the bacterial cytosol to induce lysogeny. Color White to off-white Storage Sealed storage, away from moisture and light
Sakacin P is an antimicrobial peptide containing 43 amino acids produced by Pediococcus acidilactici and belongs to the class IIa bacteriocins. Sakacin P has narrow-spectrum antibacterial activity, limited to Listeria monocytogenes. Product Details Product Name Sakacin P Biological activity Sakacin P is a 43-amino acid antimicrobial peptide produced by Pediococcus acidilactici belongs to class IIa…
Salivaricin B is a broad-spectrum bacteriocin that can be produced by Lactobacillus M7. Salivaricin B reduces cell wall thickness, leading to abnormal septum formation, and exerts rapid bactericidal activity against susceptible Gram-positive bacteria without disrupting cytoplasmic membrane integrity or dissipating membrane potential. Salivaricin B inhibits the growth of Gram-positive pathogens of the oral cavity, upper…
Product Name CCK (26-31) non-sulfated Biological activity CCK (26-31) (non-sulfated) is the N-terminal fragment of CCK, a peptide hormone found in the gut and brain that stimulates digestion, regulates satiety, and is associated with anxiety. CCK (26-31) is also less active in non-sulfated than in sulfated form. CAS Number 89911-64-8 Sequence Shortening Sequence Shortening Ac-DYMGWM-NH2…
Product Name Locustatachykinin II Biological activity Locustatachykinin II (Lom-TK II) is an insect neuropeptide with homology to peptides of the vertebrate tachykinin family. Locustatachykinin II can be used for the research of insect endocrine. CAS Number 126985-98-6 Sequence Shortening Sequence Shortening APLSGFYGVR-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
SAP 2.8 peptide is an antimicrobial peptide. SAP 2.8 peptide induces bacterial membrane rupture and permeabilization, triggers increased intracellular ROS production, and leads to bacterial death. SAP 2.8 peptide inhibits bacterial biofilm formation and disrupts preformed biofilms. SAP 2.8 peptide reduces bacterial load in animal models. SAP 2.8 peptide can be used in research on…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
