Pezadeftide
Description
Pezadeftide is a potent antifungal peptide. Pezadeftide enters fungal cells and triggers a rapid mitochondrial response, leading to mitochondrial membrane hyperpolarization.
Product Details
| Product Name | Pezadeftide |
| Biological activity | Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane. |
| Sequence | Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys (Disulfide bridge:Cys4-Cys51,Cys15-Cys35,Cys21-Cys45,Cys25-Cys47) |
| Sequence Shortening | AKVCTKPSKFFKGLCGTDGACTTACRKEGLHSGYCQLKGFLNSVCVCRKHC (Disulfide bridge:Cys4-Cys51,Cys15-Cys35,Cys21-Cys45,Cys25-Cys47) |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
